KEGG   Microlunatus phosphovorus: MLP_47970Help
Entry
MLP_47970         CDS       T01535                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00860  Porphyrin and chlorophyll metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLP_47970 (hemB)
Enzymes [BR:mph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MLP_47970 (hemB)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLP_47970 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: BAK37811
UniProt: F5XF73
Position
complement(5096943..5098046)
Genome map
AA seq 367 aa AA seqDB search
MAAVVELNLSESSLSGSTPSGSSRSGSNLSGSAGGAAGLTHRPRRLRVNSTMRAMVAETS
VAPRQLILPVFVAEGLGEPRPISSMPGVVQHPLDAMGSVATQAAEAGLGGIMLFGVPRED
RKDALGSAALADDGILNLALRAVRDEIGDALLVMSDVCLDEFTDHGHCGVLTANGVVDND
ATVEIYAAMAQVHAAAGAHVVAPSGMMDGQVGAIRSALDTAGATDVAIMAYGAKYASAFY
GPFREAVGSSLQGDRRTYQQDPANVREALREVLLDVEQGADVVMVKPALAYLDVVRAVRE
LVSVPVAAYNISGEYAMVEAAAAQGWIDREAAIDETLTSIRRAGADLVLTYWAQEWAQKW
RAGAGRG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtggttgagctgaatctgtctgagtcgagcctctccggttcgaccccctca
gggtcgagccggtccgggtcgaatctgtccgggtcggcgggcggtgcggcgggcctgacc
caccgtccacgccggctccgggtgaattcgacgatgcgggcgatggtcgccgagacctcg
gtcgcgccacggcagctgatcctgccggtcttcgtcgccgaaggactgggcgagccgcgg
ccgatctcgtccatgccgggcgtggtgcagcatccgctggacgcgatgggctcggtcgcg
acgcaggccgccgaggctgggctgggcgggatcatgctgttcggcgtgcctcgggaggat
cgcaaagacgcgctcggctcggcggcgctggccgacgacgggatcctcaatcttgcgctt
cgcgccgtacgcgacgagatcggcgacgcgctcctggtgatgtcggatgtctgcctggac
gagttcaccgaccatgggcactgtggcgtgctgaccgcgaacggtgtggtcgacaacgac
gccacggtggagatctatgcggcgatggcgcaggtccatgccgcggccggcgcgcacgtg
gtcgcgcccagcgggatgatggacggccaggtcggcgcgatccggtcggcgctggacacc
gccggcgcgaccgatgtggcgatcatggcgtacggcgcgaagtatgcgtcggcgttctac
gggccgttccgcgaggcggtcgggtcgtctctgcagggcgaccgccggacctatcagcaa
gatcctgccaatgtccgggaggcgctgcgcgaggtgctgctcgatgtcgagcagggcgcc
gacgtggtgatggtcaagccggcactggcctatctcgacgtggtgcgtgcggtccgtgag
ctggtgagcgtgcccgtggccgcgtacaacatctccggcgagtacgcgatggtggaggcc
gcggcggcgcagggctggatcgatcgggaggcggctatcgacgagacgctgacctcgatc
cggcgggccggcgcggatctggtgctgacctattgggcccaagaatgggcacagaagtgg
cgcgcaggagcgggccgtggctga

DBGET integrated database retrieval system