KEGG   Monomorium pharaonis (pharaoh ant): 105828446Help
Entry
105828446         CDS       T05760                                 

Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpha01002]
    105828446
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpha03036]
    105828446
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     105828446
Peptidases and inhibitors [BR:mpha01002]
 Cysteine peptidases
  Family C50: separase family
   105828446
Chromosome and associated proteins [BR:mpha03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    105828446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 105828446
NCBI-ProteinID: XP_012522220
Position
Unknown
AA seq 629 aa AA seqDB search
MAHITNKIVQILHECHPNKENFKDKTKNLNGSKERNESKKELEKKKLEKIKSNTEKLLTN
AQCNYVGSIEYSSLNKMLAICNLEIGNESTAIHHLVEAHAVILRQHILHRYQKTKMRESI
WNESQIYGLKPTYVKFETRFTDNNESLKVKLLDLPKEWYMIQVTAQYESPTVLRYEKQIS
SVMHAVHITILPTGTSDMEPLCVTVPRPMTQVSYDICKEIQKLLDGYTSALKTTYTNHKQ
YWMMRANQNNKMKTAINGLENIWLREWRVLFMADPIENLEIVDEIHQMIDKLISDFKFPT
DISKRCRWLLKKVSIGACFLTREEIARAIKFLLPECEKLANNIILSIYGKLPYIKKLENT
KRKTLILIIDEYMDYIAFEAMEIIKNHPVTRFPSLHVAYALFKEHEDTIVEGCKIIKARE
NMGICVVNPSGDLNKMEKRMKLFMDFWLPQWKSCYNIQPSEEMFEDALINHDILMYTGHG
NGIEYLSGEDIERMRVKSTVLLFGCSSVKLLVIGGRYPPYGVSNQYLIACSPCLLGMLWE
VTDADIDKMTANFMSNWIPSSSEKSWTEVDMDSWNYGTLKFIKNRRDGVKAKTEMESEML
RAVAKSKNSCSHYMTAAAIVARGLPIKIV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctcatattactaacaaaattgtgcaaatcttgcacgaatgtcatcctaataaagag
aattttaaggataagacaaaaaatttgaatggatcaaaagagagaaacgaatcaaaaaag
gaacttgaaaaaaaaaagttggagaaaatcaaaagtaatactgagaaattattaacaaat
gcacaatgcaattatgttggaagtattgaatatagcagtttgaataaaatgctggctatt
tgtaatttagagattggcaacgagtctacagctattcatcatttggttgaagctcatgca
gtaatacttcgacagcacatcctacatagatatcagaagactaaaatgcgcgagtctata
tggaatgaatctcaaatatatggattgaagccaacatatgtaaagtttgaaacaaggttt
acagataataatgaatcattaaaagtaaaactgttagatttaccaaaagaatggtacatg
attcaggttactgctcaatatgaatctcctactgtattaaggtacgagaagcaaatatct
agtgtaatgcatgctgtacatattacaatacttcctacgggtacatctgacatggaacca
ttatgtgtaactgtgccgagacccatgacacaagtttcctatgatatctgcaaagagatt
caaaaactattggatggctatacatctgcactaaagactacttacacaaatcataagcaa
tattggatgatgcgtgcaaatcaaaacaataaaatgaagacagctataaacggattagag
aatatatggttgagagaatggagagtattatttatggctgatcctattgaaaacttggaa
atagtagatgagattcatcaaatgatcgataaattaatatcagattttaaatttcccact
gacatatcaaaaagatgtaggtggcttttgaaaaaggtatctataggtgcatgttttctt
acgcgcgaggaaatagcacgtgcaatcaaattcctacttcctgaatgtgaaaaacttgca
aacaacatcattttatctatttatggaaagttaccatatataaagaagttagagaataca
aaacgtaaaacgttgattttaattattgatgagtacatggattacatagcatttgaagcc
atggaaattattaagaatcatcctgttactcgtttcccatctctgcatgtagcatatgcg
ttattcaaagaacatgaagatactatagtggaaggctgtaaaataatcaaagccagagaa
aatatgggaatttgcgtagtcaatccctccggtgatcttaacaaaatggaaaaacgtatg
aagctttttatggacttctggttaccacagtggaaaagttgttataatatacaacctagc
gaagaaatgtttgaagatgcgttaataaatcatgatattttaatgtatactggtcatgga
aatggcatagaatatttatctggagaagacattgaaagaatgagagtaaaatctaccgtt
ttattatttggatgtagtagtgtgaaactacttgtgataggtgggagatatccaccttat
ggcgtttcaaatcaatatttaatagcatgcagtccatgcctcttgggtatgctgtgggaa
gtaacagatgctgatattgataaaatgactgcaaatttcatgagtaattggattccttcg
tcctcagagaaatcatggaccgaagtagatatggatagttggaattatggtactctaaaa
ttcataaaaaatagaagggatggagtaaaggccaaaacagaaatggaatcagaaatgtta
agggcagtagcaaaatccaaaaatagttgttcgcattatatgacggcagctgcgatagta
gcgcgaggtttaccaataaaaatagtttaa

DBGET integrated database retrieval system