KEGG   Monomorium pharaonis (pharaoh ant): 105828833Help
Entry
105828833         CDS       T05760                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpha01001]
    105828833
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     105828833
Protein kinases [BR:mpha01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   105828833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 Pkinase_fungal APH Ly-6_related
Motif
Other DBs
NCBI-GeneID: 105828833
NCBI-ProteinID: XP_012522813
Position
Unknown
AA seq 402 aa AA seqDB search
MPLFGKKENKKIKKDGKDDRSPSVEDKYILKDLLGTGAFSEVRLAESKEKPGQMFAVKII
DKKALKGKEDSLENEIKVLRRFSESATPQSGDGSLKSDSSGEKRWLTHPNIVQLLETFED
KHKVYLVMELVTGGELFDRIVEKGSYTEKDASGLIRQVLEAVDYMHEQGVVHRDLKPENL
LYYSPDEDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVIS
YILLCGYPPFYDENDANLFAQILRGEFEFDSPYWDDISASAKDFIGKLMCVNVEERYTCK
QALAHPWISGNAASNKNIHGTVSEQLKKNFAKSRWKQAYHAATVIRQMQRLALNSGQQQQ
QQEGTGSIGPSSGNPTQYREQVNYNQHTGPLGPTPPSSNLSN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcttcgggaagaaggagaacaagaagatcaagaaggacggcaaggacgaccga
tcgccctccgtcgaggacaagtacatcctgaaggacctgctgggaacgggtgcattctct
gaagtgaggctggcggagagtaaagagaagccaggccaaatgtttgccgtaaagatcatc
gacaagaaggcactaaagggcaaggaagattcgttagaaaacgaaattaaagttttgcga
aggttcagtgaaagtgcgacaccacagagtggtgacggatcactcaagtcggatagtagt
ggcgaaaagagatggctaacccaccctaatatcgttcaattgctggagacattcgaggac
aagcacaaagtctacttagttatggagttggtcaccggaggggagttattcgatcggatt
gtcgagaagggttcgtatacagaaaaggacgcgtccggtttaataagacaagtgctcgaa
gcggtggactatatgcacgagcagggtgtcgttcacagagatcttaaaccggagaatctc
ctgtattacagtccagatgaggacagcaagatcatgatcagcgatttcggcctatcaaaa
atggaagattctgggattatggcaaccgcttgtggcacgccgggatatgtcgcacccgag
gttctggcgcagaaaccatacggcaaagcggttgatgtgtggagtataggagtcatctcg
tatattttgctgtgcggatatcctccgttttacgacgaaaatgacgccaatctgtttgca
caaattctgagaggtgaatttgaatttgactcgccatactgggatgatatcagcgcttct
gcaaaggatttcattggaaagctgatgtgcgtcaacgtcgaggaacgttacacatgcaaa
caagctcttgcacatccctggatttccggcaacgcggctagtaataaaaacattcatggt
actgtatccgaacaacttaaaaagaactttgccaagtcgagatggaagcaagcgtatcat
gcagctacggttatacgtcaaatgcaacggctagcgctaaacagtggccagcaacagcaa
cagcaggaaggtacaggttcaatcggtccctccagcggcaacccaacgcaatatcgagag
caagtcaactacaaccaacacacggggccgttggggccgacgccgccttcaagcaatctc
agcaattga

DBGET integrated database retrieval system