KEGG   Monomorium pharaonis (pharaoh ant): 105829361Help
Entry
105829361         CDS       T05760                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase isoform X1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00670  One carbon pool by folate
mpha01100  Metabolic pathways
mpha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    105829361
Enzymes [BR:mpha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     105829361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 105829361
NCBI-ProteinID: XP_012523586
Position
Unknown
AA seq 291 aa AA seqDB search
MIVDLRQSLRDKISKNEIFCSFEIASMRKPNAFYRRLLADMEEYSPLFYALTWHNEATSN
NEDYLLDLMENFPPHTLLHLVAKSLKRDDVVHILKKALALGIVNIFAIRGDSLSKSGDFE
HASDLVAFIREQFGDTFCVCVAGYPQKHPESPSKELDLHYLKAKVEAGADFIITQICFES
QVVIDFVRNCRKIGIHIPILPGLFAPASYASLQKMTDICRLDVPIEIENDLARMKNDDQA
TREYSVDMIVRIIKDVKGSGVTCGFHLFTLNRLLLVAEICKRVELLKGENS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggatttgcggcaatcgttaagagacaagattagcaaaaatgaaatattttgt
agctttgaaatcgcttccatgagaaaacccaatgcattttaccgaagacttctcgcagat
atggaagagtattcgcccctcttttacgcgttaacgtggcataacgaagcaacttccaac
aacgaagactatctattggatttgatggaaaattttccaccccatacccttttacatcta
gtggctaagagtctaaagcgtgacgatgtcgttcatatcctgaaaaaagcacttgccttg
ggaatcgttaatatatttgcaattcgaggagattcattatccaagagtggtgatttcgag
catgcatcggatttggttgcttttatcagagaacaatttggcgatacattttgcgtgtgc
gtcgctggttatccgcaaaagcatccagaatcaccctccaaggaactcgacttacattac
ctgaaagcgaaagtagaagcgggcgcggattttattattacgcaaatatgcttcgagtct
caagttgtgatagactttgtgaggaattgccggaagattggaattcatatcccgatccta
cccggactcttcgcgccagcgagttacgcgtctttgcagaaaatgacggacatctgtagg
cttgatgtgccaattgaaattgaaaacgatttggcacgaatgaagaacgatgatcaagca
acgagggaatattcagtcgacatgatagtacgaataattaaggatgtgaaaggaagcgga
gtcacatgtggttttcatttatttactttgaacagattattgttggtagcagaaatatgt
aaacgcgtagaattgctcaaaggagaaaactcatag

DBGET integrated database retrieval system