KEGG   Monomorium pharaonis (pharaoh ant): 105829403Help
Entry
105829403         CDS       T05760                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00970  Aminoacyl-tRNA biosynthesis
mpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105829403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpha03029]
    105829403
Enzymes [BR:mpha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     105829403
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     105829403
Mitochondrial biogenesis [BR:mpha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    105829403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 105829403
NCBI-ProteinID: XP_012523641
Position
Unknown
AA seq 542 aa AA seqDB search
MFSSPATKGYGRGMSRIAGWTMNKLLSAPIKEVNREICGNAVRPSEICKASVKLTSIVKP
LNAYITVTNDVAEEQANAADERQRRNSLLGQLDGIPIAVKDNYCVRGKPTTCASRMLANF
SPGYDATVYDKLRAQGAVLIGKTNLDEFAMGSGTVDSIYGPTKNLWGSEVLSQFYSCGSS
DESQITKRKLHGKDAWHIAGGSSGGSAVAVATGTCYAALGSDTGGSTRNPASYCGLVGLK
PTYGLISRYGLIPLLNSMDVPGILTRTVDDAVLILNALAGPDQADPTTVQREYVPINLSK
TIDVSNLRIGIPKEYGVQGISDEIVECWEKISRLLEDAGASVVPVSLPHTDYSIVCYSVL
NRCDVASNLACYDGIEYGHRADEWSSAHELYKRTRSEGFNDVVKDRILVGNYFLLAENYE
KYYVKAMKMRRLIAQDFDVLWNNNIDLLLTPTTLTEAPRYDEFVQLDNQTQCLIQDHCTQ
PANMAGLPAINVPIKLSRNGLPLSLQLMAPLFHEQRLLTVAKWIEQSVQFPKLELKNSCL
LE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcaccggcgacaaaaggttatggcaggggcatgtcgcggatcgcgggatgg
acgatgaacaagctgttatctgctccgatcaaggaagttaatcgggagatctgtggcaac
gcggtgcgaccgtccgagatctgtaaagcgtctgttaagctgacctcaatcgtcaagcct
ttaaacgcttatatcaccgtgacgaacgatgttgcggaagaacaagcgaatgccgccgat
gagcggcaacggaggaactcgttacttggtcaactcgacggtattcccattgccgttaag
gacaactattgcgtcaggggtaaacccacgacttgtgcttcccggatgctggccaacttt
tccccaggttatgacgccacggtttatgataagctcagggcacagggagccgtcttgatc
ggcaagactaatctcgacgagtttgccatgggctccggtactgtagactcgatttacggg
ccgacgaagaacctgtggggctcggaagtattgtctcaattctattcgtgcggttcgtct
gacgaatcacagattaccaagaggaaactgcatgggaaagatgcgtggcacatagcaggt
ggcagtagtggaggctcggcagtcgcagtagccacaggtacctgctacgcagctttgggc
tctgacactggtggttctactcgcaatcctgcatcctactgcggtctagtcggactgaaa
ccaacttacggtttgatatcgcgctacggtcttattcctctactgaattcaatggatgtg
cctggtatcctcacgagaacagtagacgatgctgtattaattttaaatgccttagctggt
cccgatcaagcagatcctactactgtacaaagagaatatgttccaattaacttatccaaa
acgatagacgttagtaatcttaggattgggataccaaaggagtatggggtacaaggcata
agtgatgaaattgtggaatgttgggagaaaatctctcgtcttctagaagatgcaggagcc
agtgtcgttccagtgtcgctacctcacaccgattactcgatagtatgttattctgtttta
aatagatgcgacgtagctagtaatttggcctgttacgacggcatagaatacggtcataga
gccgacgagtggagctcggcacatgaattgtataagagaaccagatcggaaggcttcaat
gacgtagtcaaggatcgcatactagtcggaaattattttcttttggcggaaaattatgag
aaatattatgttaaagcgatgaagatgcgtagattaattgcccaggacttcgacgttctg
tggaataacaatatagatcttctgctgaccccgactacattgactgaggctccaaggtac
gacgaattcgtgcagctggacaatcaaacacaatgtctgattcaggatcattgtacgcaa
cccgcaaatatggctggtttgcccgcgatcaatgtcccgatcaagctgtctcgcaatgga
ttacctttatccttacaattaatggcgccgctctttcacgaacagagattacttaccgta
gcaaaatggatcgaacaatcagtacaatttccgaaactagaactaaagaattcatgtttg
cttgaataa

DBGET integrated database retrieval system