KEGG   Monomorium pharaonis (pharaoh ant): 105829517Help
Entry
105829517         CDS       T05760                                 

Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04013  MAPK signaling pathway - fly
mpha04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105829517
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105829517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpha01009]
    105829517
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105829517
    3.1.3.48  protein-tyrosine-phosphatase
     105829517
Protein phosphatases and associated proteins [BR:mpha01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    105829517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT SSP160 Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 105829517
NCBI-ProteinID: XP_012523885
Position
Unknown
AA seq 243 aa AA seqDB search
AAVADPTATTTVSGCTSPGPGCPVLSISGPPTPQPADIDNHPASRVLPFLYLGNGRDAAD
LQLLRALGATRVLNVTSQLPGYHEERGITYRQIPASDSGHQNLKQYFEEAFDFIEEARKA
GSSVLVHCQAGVSRSATIAIAYIMRHKGLSMVEAYKLVKNARPIISPNLNFMGQLLELEQ
GLRASGDVANSAPEEPTTATATSTTTTTTTTSSTTATTTGSCHQCRWSHQPSSEEVVTSG
CSV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gccgccgtcgccgatccgacggcgacgacgacggtgagcggctgcacgagtcctggtcca
ggttgccccgtgctgagcatctccggcccgccgaccccgcagccggccgacatcgacaac
cacccggcgtcccgcgtgctgccgttcttgtatctcggtaacggcagggacgccgccgac
ctgcagctactgcgcgccctcggcgccacccgggtgctgaacgtcacctcccagctgccc
ggctaccacgaggagcggggtatcacgtacaggcagatacccgcctcggattccggccat
cagaaccttaagcagtacttcgaggaagcgttcgatttcatcgaggaagcgcggaaggcc
ggaagcagcgtgctggtgcactgtcaagctggtgtgtcgcgcagcgcaacaatcgcgatc
gcttacataatgcggcacaaaggcctgtcgatggtggaggcgtacaagctggtgaagaac
gcgcgtccgatcatcagtccgaacctgaacttcatgggtcagctgttggagctcgagcag
ggtctgcgggcgtccggcgacgtcgccaactccgcgccggaggagcccacgacggcgaca
gcaacgtcaacgacgacgacgacgacgacgacgtcgtcgacgacagctaccacgacgggt
agttgtcaccagtgcaggtggagtcatcagcctagcagcgaagaggtagtcacctctggc
tgcagcgtctga

DBGET integrated database retrieval system