KEGG   Monomorium pharaonis (pharaoh ant): 105829544Help
Entry
105829544         CDS       T05760                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00562  Inositol phosphate metabolism
mpha01100  Metabolic pathways
mpha04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105829544
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105829544
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     105829544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka C2 PI3K_rbd PI3K_C2 PX DUF4135 Auxin_repressed
Motif
Other DBs
NCBI-GeneID: 105829544
NCBI-ProteinID: XP_012523944
Position
Unknown
AA seq 1778 aa AA seqDB search
MSHYAGRNTYDQKTAVIDHERKYQEDLEQAKALSLESLALEKYRLEKLRLELSNVRQQTC
VTQNNVCNTNSTSETDSNSQGERSQCRSRPRPSINTNQKSNTVILPPPIPLRRNSTTVSS
QDSSTDLINFTSPVKQDNLVEYCTAPPPPPPKTLVEPKWDSHPSLLKKQSRVSRSNSSVG
AYHSRDFRYHSLSPGPRSSTAPCTPGTPGISPIMSRASSISNNVSDVAPQPAWNSIFSNF
FFSQIPPLPMNYRPTVAPATSASFCMDDEQLNVLKVIEKKPNSNLIDLNSFEQTEDKTNV
RVSVLEAFDPLLIKTDNGNNSTQEHQVKDLQSQVSGSVYDPFDPFDYMYSTNESVNSDPV
YAAVEKSAKSPAVSPAAPPPLPPRNSAAWNTIERRRTSLDRRQKRQTRLYENVTVIKARS
SLHDCDLKAFHNMIKSIRSDFPFNNPSTNIGYVVSPIMENLYPDGTSIKLVVHPQLPNND
KETPSITFTCNVNCSVEHVILNVACSLEDEDTVNVEKYCLRVWGLAEYLAPNTTLAQYEY
IHLCIKLEKDIELAIMTRAQIKQSIARTLHDDNCDQSLRLEDILPNEPSQPISYDTLIIL
LETVEKEMERVETAALQLATTNQGPTLLPQLQPHGAVQAVKAVCALMGNIETFEITEAID
NFVNACCQFLPQVHTANIECKKPEIIHEDGDYAVVTLRKKFPDVIASHCHKIRDAIQELV
ETYCHAFKVDFQLNSKGEFPTNTLIATEVIDTILVRVGALHRLPTTWKHDDYIVAAQIFH
GTRPVGNPVLSEPMTVSTNFHPRILFNIWLEFRGISVCQVPREARLVLVLYGRTLQPAEH
ESNSSAENAMEKEELGWGAIQFFDYDGVMSQGSFFLSLWPAIADKRLGPAPAPGIHPGGD
THPIIGVELPDYGGKVLFPNSSELRDYDVDSLDFNSLDQNTQELLIGITQQDTFSRPPIE
DREILWEKRHYLHDRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF
PDMKVREMAVDWIRELSNDELVDYLPQLLQAMKHETYETSPLTRFLLERALLSPRVAHHI
YWLLNQALPGQSPQVQNSAEIAAEDDKAISCARYQRRLQLMLRALLAVIGGALRKSFLTQ
QLLVKNLHEVAENIKVTKESLRLDTLKTGLQNIHCQLMEDDGTCLPLSPSKLVFGINVQT
CAYFPSFTLPLKINFISCDNVINPAIFKVGDDLQQDMLTLQMVRIMDKLWLKEGLDLKMV
TFACVPTGHKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERAVE
NFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFV
LTSDMAYVINGGDKPSAKFHHFVDLCCQAFNIVRKHGNLILHLFGLMTSSGIPGVTVDAV
SYVQKALLPGQTNPEAAATFARMIESSLKNWFTQFNFFLHNLAQMRFSGDHSEGELLSFV
PRTYTMQQEGELTSVQVYGYQKRYDPEKYYMYILRIQRKGQPDPTYLFRTYKEFCEFYQK
LCIHFPLAKVTSLSSGISVGRSNIQQVADKRRADIEKFLVSLFKMAPEISQSDLVYTFFH
PLLRDQKNADIHLRKVKVGNNWWAEKRVRDNVQSGQIKLAFHYDRGTLSVMVYHARGLPK
VANAQEPNTYVKVYLKPDPTKATKRKTKVVKKNCHPSFMEMLVYRMPLEVIKERILEATI
WNHDTLQENEFLGGISLPLERFDLTNETIEWFSLVNVR
NT seq 5337 nt NT seq  +upstreamnt  +downstreamnt
atgtcacactacgcaggtagaaacacctacgatcaaaagaccgcggtgattgaccatgaa
aggaaatatcaggaggacttggagcaggccaaggccctcagtctggagagcctggctctg
gagaaatacaggttggagaagttgcggctggagctcagtaacgtgcggcaacagacgtgt
gtcacgcaaaacaatgtgtgcaatacaaacagcacatcggagacggatagtaattcacaa
ggagaaaggtctcaatgcagaagtcgaccaaggccttcgattaacactaatcaaaagagt
aatacagtaatactaccacctccaataccgttaagaagaaactcgactactgtgtcaagt
caagattcttctactgatctaataaatttcacaagcccagtaaagcaggataatctcgtt
gaatattgtacagctccacctccgccaccgccaaaaacactggtagaacctaaatgggat
agccatccctcgttattgaagaaacaatcaagagtgtctcgaagcaatagctcagtcggt
gcataccactctagggacttcaggtatcattccctttccccaggcccgcgatcttccaca
gcaccatgtacaccgggaacaccgggaattagccccatcatgtcaagagctagtagcatt
agcaataatgtatctgacgttgcaccacagcctgcatggaactctatctttagcaatttt
ttcttctcgcagattcctccattgcctatgaattatagaccaactgttgcacctgccaca
agtgcttcattttgtatggatgatgaacagttgaatgtattaaaagtgatagagaaaaag
ccaaatagtaatcttatagatctaaatagtttcgagcaaaccgaggataaaaccaatgta
cgagttagcgtattggaggcatttgatccattacttattaaaactgacaatggaaataat
tccacgcaggaacatcaagtaaaggatttgcaatcacaagttagtggcagtgtatacgat
ccattcgatccgtttgattatatgtatagcacaaacgaaagtgtcaattcggatccggtt
tatgccgctgtggagaaatctgcaaaatcaccagctgtatcgccggctgcgccacctcca
ctgccacctcgaaattcagctgcatggaataccatagaaagacgaagaacttctttagat
cgccgacagaaacgtcaaacacgattgtatgaaaatgtaacagtcattaaagctagatca
tctttgcatgattgtgatctgaaggcgtttcacaacatgataaagtctatacgaagcgat
tttccatttaataatcctagtacaaatattggatatgttgttagcccgataatggagaat
ctatatccagatggtacaagtataaaattagtagttcatccacaattacctaataacgat
aaagagacaccatctatcacttttacttgtaatgtaaattgcagtgtcgagcatgttatc
ttgaacgtcgcctgctccttggaggatgaggatacagtaaatgtagaaaaatattgttta
agagtatggggattagccgaatatcttgcacctaatacaaccttagcacaatacgaatac
atacatttgtgcattaaattagaaaaagatattgaattagctataatgaccagagcacaa
attaaacaatccattgctagaacgctgcatgatgataattgtgatcagtctctaagatta
gaagacattttaccaaatgaaccatcgcagcctatttcatatgatacattaattatttta
ctagagacagtagaaaaagaaatggaacgcgtagagactgcagcattacagttggcaacc
acaaatcaaggtcctactttattacctcaacttcaaccgcatggcgcagtgcaggcagtg
aaagcagtgtgtgccttgatgggaaatattgagacgttcgagattacggaggctattgat
aattttgtaaatgcttgctgtcaatttctgccgcaagttcacacagctaatatagaatgt
aaaaagcccgaaattatacacgaagatggcgattacgctgtggttactttgaggaaaaag
ttccctgacgtgattgcctctcattgtcacaaaattcgcgatgctattcaggaactcgtt
gagacgtactgtcatgcattcaaagtcgattttcaattaaatagtaaaggagaattcccg
acaaatacactgattgcaacggaagtgattgatactattttggtacgtgttggagctcta
cacaggctaccaacaacatggaaacatgacgattatatagtggcagctcaaatctttcat
ggaactagaccggtcggaaatccagttttatcggaaccaatgacggttagcacgaatttt
cacccaagaatcttatttaacatatggttggaatttcgcggaataagtgtgtgtcaagta
ccacgggaagccagacttgtattagttctttatggacgcacgctacaacctgcagagcac
gaatccaattcgtccgcggagaatgcaatggagaaagaagaactcggatggggtgcaata
caattcttcgattatgatggcgttatgagccaagggagtttttttctgtctctctggcca
gctattgcagacaaacgattaggtccggcgccggcgcctggaattcaccctggtggtgac
actcacccaatcataggagtagaattacctgattatggaggaaaggtgttattccccaat
tcctcggaattgcgagattatgacgtagattcgttagactttaattcgttagatcaaaat
acgcaggaattattaataggtattacacagcaagatacattctcaagaccacctattgaa
gacagggaaattctgtgggagaaaagacattatttgcatgatagacctgaagctttaccg
aaagtattactagctgcacatagttgggattgggcgtgcttaccggatttacacgcgtcg
cttagaatttggagtccattgccaccagtacaagcgttacaattacttttaccgtgcttc
ccagacatgaaagttagagagatggcggttgactggattcgtgaattaagtaatgacgaa
ctggtcgattatttgccacagctacttcaagcgatgaaacatgagacgtacgaaacgtca
cctttgactcgattcttattagaacgtgccttactatcgccgagagtggctcatcatatt
tactggttgctaaatcaagcgctgccgggacaaagtccccaggtacagaattctgctgaa
attgccgcggaagatgacaaagctattagttgtgctcgttatcaacgaagattgcaatta
atgttaagagcgctattagcagttatcgggggtgcactgagaaaaagttttctcactcaa
cagctacttgttaaaaacttgcacgaagtggctgagaatatcaaagttacaaaggaatca
ttacgattggatacgcttaaaaccggtttacaaaatatacactgccagttaatggaagat
gatggaacatgtttaccattatctcccagtaaactagtattcggtatcaatgtacagaca
tgtgcctatttcccgtcgtttactcttccgctgaaaattaattttatcagttgtgacaat
gttataaacccggcaatctttaaggttggcgatgatttgcaacaggatatgttgaccctc
cagatggtacgcattatggataaattatggttgaaggaaggtctcgatctgaaaatggtt
accttcgcctgtgtacctaccggtcataaacgtggaatgatagaaatggtaacaaacgcg
gaaacattacggaagatccaagtcgagttcggactaactgggtcttttaaagaccgacca
attgcggaatggttggcaaagcataatccctcagaactggaatatgagagagcggtggaa
aatttcaccgcttcttgcgccggctatagtgttgccacttatattttaggaatttgtgat
aggcataatgataatattatgctaaagacatctggtcacttgtttcatattgacttcgga
aaatttctcggtgacgcgcaaatgtttggaaactttaagagggataggacgccatttgtg
ttgacgtctgatatggcatacgttataaatggtggtgataagccttcagcgaaatttcat
cactttgtggatttatgctgtcaggcttttaatatagtgcgcaaacatggaaatcttatt
cttcacctttttggattgatgacttcgtctggtatccctggagtaaccgtagacgcagtc
agttacgtacaaaaagctctgcttcccggacaaacaaatcctgaagcggcggcgactttc
gctcgcatgatagaaagttcactgaaaaattggtttacgcaattcaacttctttctgcat
aatctggcgcagatgagattttccggagaccacagtgagggagaactcttatcctttgtt
ccacgcacgtacacaatgcagcaagaaggtgaattaacgagtgttcaagtttacggatat
caaaaacgctatgatccagagaaatattatatgtacattttacggatacaacggaagggc
caaccggatccaacatatctattccgaacgtacaaagaattttgtgaattttatcaaaaa
ttgtgcatacattttccacttgctaaagtaaccagtttatcaagtggaatcagcgtggga
cgatctaatattcagcaagtagccgataaacgacgagcagatatagaaaagtttcttgta
agtctatttaaaatggcgccggaaatatctcaaagtgatttggtgtacacttttttccac
ccgctactacgagatcaaaagaatgctgatattcatttacgtaaagtcaaagttggaaat
aattggtgggccgaaaagagagttagagacaacgtccaaagtggtcagattaaattggct
tttcactacgatcgtggcactttatctgttatggtttatcatgcccgaggactgccgaaa
gtagccaatgctcaagagccaaatacatacgtgaaagtatatcttaaacctgatcctaca
aaagcgacaaaacggaaaacaaaagtagtaaagaaaaattgtcatccgtcatttatggag
atgttggtgtatagaatgcctctagaagtgattaaagagagaatacttgaagcaacgata
tggaatcacgatactctgcaggagaatgaatttctcggtggtataagtttgccgctcgaa
cgtttcgacttgacgaacgaaactattgaatggttctcattagttaatgtacgatga

DBGET integrated database retrieval system