KEGG   Monomorium pharaonis (pharaoh ant): 105830798Help
Entry
105830798         CDS       T05760                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00061  Fatty acid biosynthesis
mpha01100  Metabolic pathways
mpha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105830798
Enzymes [BR:mpha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     105830798
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     105830798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA RmlD_sub_bind 3Beta_HSD 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 105830798
NCBI-ProteinID: XP_012525841
Position
Unknown
AA seq 249 aa AA seqDB search
MSKLIPGKLAFVTGAGSGIGREVCRVFAREGATVVATDQNIKTAEETVATLEGAGHAALN
VQVTDRNSVETAFKHVLKQFSRPPTIIVNSAGITRDNFLVKLSDNNFDDVINVNLKGTFL
VMQTAVKAMMEANATKNSSIINISSIVGKRGNIGQSNYCASKAGVVAMTKSASMEFGQFG
IRVNVVLPGFIDTPITATVPDKVKDLFIKNIPLQRLGKPQEVAEVIAFLASDKSSYVNGA
SIEVTGGMY
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacttatacctggaaaactggcatttgtcaccggtgctggaagtggcattgga
agagaggtgtgtcgagtttttgcccgggaaggtgctactgttgttgcaactgatcaaaat
attaaaactgctgaggaaactgttgccactttagaaggtgctggacatgctgcattaaat
gttcaagtcactgatcggaatagtgttgaaacggcatttaaacatgtcttgaagcaattt
tcaagaccacctaccattattgtcaattcagcaggcattacacgggataattttttagta
aagctcagtgataataactttgatgatgtaatcaacgttaatttaaagggtacttttcta
gttatgcaaactgctgtcaaagcaatgatggaggcaaatgcaactaagaattcttcgatt
atcaatatcagttcaattgttggtaaacgtggaaacattggacaaagtaactactgcgca
tcaaaagctggagtggttgctatgacaaagagtgcttccatggagtttggacagtttgga
attcgggtaaacgtcgtattgcctggttttatagatactcctataactgcaactgtacct
gacaaagttaaagatttatttataaaaaatataccgttgcaaagacttggaaagccgcaa
gaagtggcagaagttattgcatttttagcttctgataaaagttcttatgtaaatggagca
tctattgaagttactggaggaatgtattaa

DBGET integrated database retrieval system