KEGG   Monomorium pharaonis (pharaoh ant): 105832430Help
Entry
105832430         CDS       T05760                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00020  Citrate cycle (TCA cycle)
mpha00640  Propanoate metabolism
mpha01100  Metabolic pathways
mpha01200  Carbon metabolism
Module
mpha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105832430
   00640 Propanoate metabolism
    105832430
Enzymes [BR:mpha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105832430
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105832430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 105832430
NCBI-ProteinID: XP_012528802
Position
Unknown
AA seq 332 aa AA seqDB search
MAVAARSLSKFAVRNCGSLLRSQVRFNYTETRKNLKIDANTKVICQGFTGKQGTFHCQQA
LDYGTKIVGGVSPKKAGTEHLGKPVYKSVKEAKEATGATATVIYVPPPAAASAIMEAIDA
EMPLIVCITEGIPQHDMVKVKRRLLEQNKSRLIGPNCPGIIAPEQCKIGIMPGHIHQKGK
IGIVSRSGTLTYEAVNQTTLAGLGQTLCVGIGGDPFNGTDFIDCLDVFLTDPDCDGIIMI
GEIGGSAEELASEYLIEKNTGGKAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQDKI
NALEKAGVIVTRSPAQMGNELLKEMTRLGLIN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgccaggtcgttatccaaattcgctgtcagaaattgtggaagtttatta
cgctctcaggtgagatttaattacacagaaactaggaagaatttaaaaattgatgcaaat
accaaagtaatatgtcaaggttttactggaaagcaaggcactttccattgccagcaagcg
ctcgattatggtacaaagatagtaggtggagttagtcccaaaaaggctggaacagagcat
cttggtaaaccagtgtacaaatctgttaaggaggcgaaagaagcaactggtgctaccgcg
acagtcatttacgttcctcctccagctgcagcatcagctattatggaagcaattgatgca
gaaatgccgctaatcgtttgtattacggaaggtattcctcaacatgatatggtcaaagtg
aaaaggcgactactcgaacaaaataagtcacgtttaattggtccaaactgccctggaata
atagcacctgaacaatgtaaaattggtattatgcctggtcatatacatcaaaagggaaag
attggcattgtctcaagatcgggaactctaacttacgaggctgtgaatcaaacgacactt
gcgggacttggacaaacattatgtgtcggcattggcggcgatccgttcaacggtaccgat
ttcattgactgtttggatgtatttcttaccgacccagattgcgacggtattataatgata
ggagagattggaggcagcgctgaggaactcgcatcagaatatctcattgagaagaatact
ggtggaaaagctaaaccagtggtatcattcattgctggtcttactgcaccacctgggcga
agaatgggacatgctggtgccataatctcaggaggaaagggtggggcccaagacaagatt
aatgcacttgaaaaagctggtgtaatagtaacaaggagtcctgcacaaatgggtaatgaa
cttctgaaggaaatgacacgtctcggcttgattaattga

DBGET integrated database retrieval system