KEGG   Monomorium pharaonis (pharaoh ant): 105833488Help
Entry
105833488         CDS       T05760                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II alpha chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04310  Wnt signaling pathway
mpha04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105833488
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    105833488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpha01001]
    105833488
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     105833488
Protein kinases [BR:mpha01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   105833488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Kdo Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 105833488
NCBI-ProteinID: XP_012530718
Position
Unknown
AA seq 531 aa AA seqDB search
MSLPTACTRFSDNYDLKEELGKGAFSVVRRCVQKSTGHEFAAKIINTKKLSNRDFQKLER
EARICRKLQHPNIVRLHDSIQEENFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
LESVHHCHHNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEAQAWYGFAGTPGY
LSPEVLKKEPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYGQIKAGSYDYPSPEWDT
VTPEAKNLINQMLTVNPGKRITALEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSSKYDTQGRSIITKKGDGSQVKESTDSSTTLEDDDIKEDKKGGVDR
SSTVIAKEPEDIRIMCPIKTCSQLSTNSQCSARRQEIIKMTEQLIESINTGDFEAYTKIC
DPHLTAFEPEALGNLVEGMDFHKFYFDNAVLGKNCKAVNTTILNPHVHLLGEDAACIAYV
RLTQYMDKQGVAHTQQSEESRVWHKKDNKWQNVHFHRSAVTGPSPFSFNHK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgccaacggcttgcacgcggttcagtgacaattacgatctaaaggaggaactc
ggcaaaggtgccttctccgtggttcgacgatgtgtccaaaaaagcaccggtcacgagttt
gctgcaaaaatcataaacaccaaaaaactttccaacagagatttccaaaagcttgagcgt
gaagcgcggatatgtagaaaactgcaacatccaaatattgtaagattacatgacagtata
caagaagagaatttccattatcttgtctttgatctagtcaccggcggagaactgttcgag
gacatcgtcgcccgggaattctacagcgaggcggacgcctcgcactgtattcaacaaatt
ctggaaagcgttcaccactgccatcataacggagttgtgcaccgggatttgaaacctgaa
aatttactcctcgcgagtaaggcgaaaggagcggctgtgaaattagcagattttggtttg
gcgatcgaagtgcagggtgaagcgcaagcatggtatggttttgctggaacgcccggctac
ctcagtccggaggtgctgaagaaggagccatacgggaaaccagtcgacatatgggcgtgc
ggtgtcatattgtacatccttctggtcggttacccacctttttgggacgaggatcaacat
cggctctacgggcagatcaaggccggatcgtacgattatccgagtccagaatgggacact
gtcacgccggaagccaagaatcttatcaatcaaatgttgacggtgaatccaggaaagaga
atcactgccctcgaggcactgaagcatccatggatttgccaacgtgagcgtgttgcatct
gtagtgcacagacaagagaccgtggattgtttgaagaaattcaatgcaaggcgtaagtta
aagggcgctatattgacgaccatgctggcgacgcgaaacttttccagtaagtatgataca
cagggtcgaagcatcatcacaaaaaagggcgatggttctcaagtgaaggaatctaccgat
agcagtacaacgcttgaagacgatgatattaaagaggataagaagggcggcgtcgaccgg
agcagcacggtcattgccaaagaacccgaagacataagaatcatgtgtcctatcaagacc
tgcagccagctttcaaccaactcccagtgctcagcacgccgacaggaaatcattaagatg
accgagcagttgatcgagagcatcaacaccggagatttcgaggcatacacgaaaatctgt
gatccacatctgaccgcgtttgaaccggaggctctaggtaatttagtcgagggaatggat
ttccacaaattttactttgataatgcagtcctggggaaaaactgtaaggctgtcaatacg
acgatcctgaatccccatgtccatttgctcggtgaggatgccgcttgcatcgcgtatgtc
aggctgacgcagtacatggacaaacaaggcgtagcgcatacccagcagagcgaggaaagc
cgtgtgtggcacaagaaggacaacaagtggcagaacgtgcatttccatcgaagcgcggtg
acgggcccatccccgttctccttcaatcacaaataa

DBGET integrated database retrieval system