KEGG   Monomorium pharaonis (pharaoh ant): 105834649Help
Entry
105834649         CDS       T05760                                 

Definition
(RefSeq) tankyrase isoform X1
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpha03032]
    105834649
   03036 Chromosome and associated proteins [BR:mpha03036]
    105834649
Enzymes [BR:mpha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     105834649
DNA replication proteins [BR:mpha03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     105834649
Chromosome and associated proteins [BR:mpha03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     105834649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 105834649
NCBI-ProteinID: XP_012532753
Position
Unknown
AA seq 1209 aa AA seqDB search
MAGRRSTLSNAADSLPGSGGGGGGVGVGGGDPLRELFEACKTGDLAKVKALVNPKTVNAR
DTAGRKSTPLHFAAGYGRKDVVEFLLSAGASIQARDDGGLHPLHNACSFGHCDVVRLLLE
AGASPNTRDNWNFTPLHEAAIKGKIDVCITLLQHGADVNIRNTEGKTALEVADVSTKPVL
TGEYRKDELLEAARSGNEERLLQLLNPLNVNCHASDGRRSTPLHLAAGYNRSRVVQILLQ
NGADVHAKDKGGLVPLHNACSYGHFEVTEALLKHGAAVNASDLWTFTPLHEAASKSRAEV
CSLLLSEGADPTQLNCHSKSAIDVAPTLELQERLAYEYKGHCLLDACRQADLTKLKKYLS
QEVVNFKHPYTGDTPMHCAVASPYPKRKQVIEALIRKNAAMNEKNKDFLTPLHVATDHSH
YDAMDILLRHNAKVNALDGLGQTALHRCAREDNVQACRILLSYNIDPSIVSLQGYTATQI
AAENVLKILQDPPNGTDDVEAQLLEASKSGDLAAVERILQANPHAVNCRDLDGRHSTPLH
FAAGFNRVPVVEYLLAHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNVADLW
KFTPLHEAAAKGKYEIVRLLLRHGADATKKNRDGATPLDLVRDGDQDVADLLRGNSALLD
AAKKGNLARVQRLVTQDNINCRDAQGRNSTPLHLAAGYNNLEVAEFLLERGADVNAQDKG
GLIPLHNASSYGHLDIAALLIKYNTVVNATDKWGFTPLHEAAQKGRTQLCALLLAHGADP
FLKNQEGQTPVDLASADDVRCLLQDAMASQQIVPSVPSGNSAGSNSINSRPPSIVSVPVT
PPPPLTQETVIMPSGAAMTLCVPLARPTSCLSPMPPSESCSEKESKDMCKEHNSITTVAG
FLQSLGLEHLLELFEREQITLDILAEMGHEDLKQVGVSAYGYRHKLIKGMDKLLNTAAGS
LWQPSINPGTLLVDLLTEDKEFLAVEEEMQSTIRQHRDNGHSGGIFSRYNIVRIQKVQNR
KLWERYAHRRQEVAEEVGAAAPSSPSTGPRGTSNSTVSQANERMLFHGSPFINAIVQKGF
DERHAYIGGMFGAGIYFAEHSSKSNQYVYGICGGTGCPAHKDRSCYICHRHLLLCRVTLG
KSFLQFSAMKMAHAPPGHHSVMGRPSQGGLVFPEYVVYRGEQAYPEYLITYQIARPQQES
NGSDGVEER
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atggcaggacgtagatcgacgctgtcgaatgcggcggactcgctgccgggctcgggcggc
ggcggcggcggtgttggcgttggaggcggcgatccgctacgtgaactcttcgaggcctgc
aagaccggcgatctcgccaaggtgaaggcgttggtcaacccgaagacggtcaacgcccgc
gatactgccggacgcaagtccacccccctgcactttgcagctggatatggtagaaaagac
gttgtagaattccttttgtctgccggtgcgtcgatccaagcacgcgacgacggtggtcta
catccgttacataatgcgtgctcctttggacattgcgacgttgtgagattacttttagag
gcaggagcaagtccaaatacgagagacaattggaattttacacctttacatgaggctgcg
atcaagggtaaaatagacgtatgtattactctgctacagcatggagcagatgtaaacatt
aggaatacagaaggaaagactgcattagaagtagcagatgtctctacgaaaccggtacta
acgggagagtatagaaaagatgagctcttagaagcggctcgatccggaaatgaggaaaga
ttgttacagctactaaatcctcttaatgtcaattgtcacgccagtgacgggagaaggtct
acacctttacatttggcggccggatataatagatctagggttgtacagattcttcttcag
aacggcgcggatgtacatgccaaggataaaggaggtctcgtgccgcttcataacgcgtgt
tcgtatggccactttgaagtaaccgaggcacttctgaaacacggtgccgccgttaacgcc
agtgatctctggacgtttactccattgcatgaagccgcgagtaaatccagagcagaagtt
tgttctctgctgttgagtgaaggcgcggatccgacacaattaaactgccatagtaaaagc
gccattgacgtggcaccaactcttgaattacaagaaagactagcgtacgaatataagggt
cattgtctattggacgcctgcaggcaggcagatcttactaagcttaaaaagtatctgtcg
caagaggtcgttaatttcaaacatccttacaccggtgatacaccgatgcattgcgcagtg
gcgtcaccgtatcccaaacgaaagcaagttatcgaggccttgatccgaaagaatgctgcc
atgaatgaaaaaaataaagactttcttacgccacttcacgtggcgactgatcattcgcat
tacgacgcgatggacatattgctgcggcacaatgcgaaagtcaacgcactagatggcttg
ggacaaaccgcgctgcacaggtgtgctagagaggataatgtgcaagcttgcagaatactc
ttgtcttataatatcgacccttcgatagtatctcttcaagggtatactgcaacacaaatt
gctgctgagaacgtattaaaaatattgcaagatccaccaaatgggaccgacgatgtagaa
gcacaactgttagaagcgagcaagtcgggcgatcttgctgcggtagaaagaattttgcaa
gccaatccacatgctgtgaattgccgcgatttggacggaaggcactccactccactgcat
tttgcagcgggttttaatagagtgccggttgtagaatatttattagcacacggcgcagat
gtgcatgccaaagataaaggcgggttggttcctcttcataacgcttgttcttatggccat
tatgaggttacggaattattagtgaaacatggggcatccgtgaatgttgctgatctgtgg
aaatttacgccgcttcacgaggccgccgccaaaggcaaatacgaaatagttcgattatta
ctgagacacggagcggatgccactaaaaagaatagagacggcgcaacaccattagacttg
gtaagagacggtgatcaggatgtagcagatctcttacgtggcaatagcgctcttttggac
gccgcgaagaaaggcaatttagccagagttcagagattggttacgcaagacaacatcaac
tgtcgagatgcacaaggacgcaatagcactccattacatttagctgcgggatacaataat
ttggaagtagctgaattcttacttgaacgaggagccgatgtaaacgcgcaagataaaggt
ggtcttattccgctgcataatgcgtcaagttacggtcacttggacattgcagccttactt
attaaatataatactgtggtgaatgcaactgataaatggggatttacaccactccatgaa
gctgcacaaaagggtcgaacgcagctgtgtgcccttctgcttgctcacggcgccgatcct
tttctaaaaaatcaggaaggtcagactccagtggatttggccagcgcggatgatgtaaga
tgtttattacaagatgctatggcttctcagcaaatcgttccatcggtaccatcgggtaac
agtgctggtagcaattctattaacagtagaccacccagtatcgtatctgttcctgttaca
ccgccaccgcctctcactcaagaaacagtcattatgccatcaggtgcggccatgactcta
tgcgtgccattggctcgcccgacatcgtgtctgagtccaatgccaccgagcgaatcatgc
tccgaaaaagaatccaaagatatgtgtaaagaacacaatagtatcacgaccgtcgccggt
tttctgcaaagtcttggtttagaacatctactcgaactatttgaacgcgagcaaatcact
ttggacatattagcggaaatgggtcacgaggatttgaagcaagtcggagtgtcagcttat
ggttatagacacaaattaattaaaggtatggataagctgctgaatacagcggcgggctcc
ctctggcagccttccataaatcccgggacattgctggtggacttattaacagaagacaaa
gaattcttggctgtcgaagaagaaatgcaaagtaccattaggcaacatagagataacggt
cattctggtggtatcttctctcgatacaacatagttagaatacaaaaagttcagaatcgc
aagttgtgggaacgttatgctcatagaagacaagaagtagctgaagaagtcggcgctgcc
gctccttcttctcctagtaccggacctagaggtacttctaattcgacagtatcacaggcg
aatgagagaatgttattccacggcagtccatttatcaacgctatcgttcaaaaaggcttc
gatgaacggcacgcatatattggcggaatgttcggcgctggcatatatttcgcggaacat
agcagtaaaagcaatcaatatgtttacggtatatgcggcggtactggatgccccgcacat
aaagacagaagctgttacatttgccacagacatttactgctctgtagagttacactcggc
aagtcgtttctacaattttcggcaatgaaaatggcacacgctcctcccggtcatcatagc
gtaatgggcaggccgtcacagggcggtttggtgtttcccgagtacgttgtttacagaggc
gaacaggcatatccggaataccttatcacgtaccaaattgcgaggcctcaacaggaaagc
aacggtagtgatggcgttgaggaacggtga

DBGET integrated database retrieval system