KEGG   Monomorium pharaonis (pharaoh ant): 105834798Help
Entry
105834798         CDS       T05760                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpha01001]
    105834798
   01009 Protein phosphatases and associated proteins [BR:mpha01009]
    105834798
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105834798
Protein kinases [BR:mpha01001]
 Serine/threonine kinases: Other
  Wnk family
   105834798
Protein phosphatases and associated proteins [BR:mpha01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105834798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 105834798
NCBI-ProteinID: XP_012533004
Position
Unknown
AA seq 3129 aa AA seqDB search
MPRCYNDSKTVSSVNSNYKHGTDDIILTQSHAFSIGSQLNVDEDPPVVEKSHRRLRCDLS
PVPTSANSNLNIKFLGLKGNKGVRQDHQVSTGSGGHRERNREIKKRAAIGNTVRGFFSSG
HSRQDRYETNRQRSSGGTGGGLSSLCPKLVASGISDGQSGSNLGVGHLASPESGVVQRIH
AHTHRRQRKLSIVTQAGPSANTTGDRKVLSNISRSANISKKQIRIQRHDQSTDSLSITSN
GLATSSPSCKKKVLSALRISDRSSTPSVNSSSFDHENDRSFSDAEEALAATENAFTTLGS
SSIPSTPVSKAKSAKLGKNEEANVEHVPVECSDSSRNAADVQHVILNEFEQKNVMSIKSS
AVHELHAVNQESIINDKQKSSSSTLDARSISSSDQKVLKHKNINSAEKMIEHHNSKDIET
ANVERDLNDTTISMEMNSTDDSNEGKQGKNRKSEEYIDGGDDTNKEITDPLNAVSSTKEE
KITRVKSNVNLSEEVIKNSRFVTSKVLEEVTDADTKTVDVEKGEEERVTIYDDDGTSISD
IVATQALHESLSKLGKVPPLDSEIDENTTLRDEAKMREHSEKDVVTQEETAEGFIGPLLD
ENFKADEKLSQKTMAMEEVQNLLMKVKVQTVEDDDDEEKAVGISPDGRFLKFEEEIGRGS
FKTVYRGLDTQTGVAVAWCELQEKKLNKTERLRFREEAEMLKGLQHPNIVRFYDYWEVTL
TRRKYIVLVTELMTSGTLKTYLRRFKKINPKVVKSWCRQILKGLSFLHSRSPPIIHRDLK
CDNIFITGTTGSVKIGDLGLATLKNRSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMC
MLEMATSEYPYSECTGPAQIYKRVVSGVKPQSYDKVENPEVRDIIEMCIRLKKEERPLVK
DLLNHEFFADDVGLKLEMVSRDSAVADTELSRVEFRLRVLDPKKRSNKHKENEAIQFDFD
IQADNAEEVALEMAKSSLILEEDAKAVAKMLKSQITTLLREREDRKAKEEKERLDRENAG
TTTDVTANAANAESLLQQQLLLQQMQLQQQQQQQQQQQPQIQSNINIQMQNPVSMQLPQT
QMPIQQQQLQSTAQQAPQHNLQAQQVQLVQQQPIIQQQTPVVQPQQAQQIQYQQQIQQQY
QQQQQQQYPQHVPQSLNANSPQCSTPQNLQAQPQFPQVQQQQHVHQQQQYIQLNQMSVPQ
QIPHQMQQQMQPQMQILPQQQHMHQQLQQQQYVAQPQLQHVQQLHQHTVGSPPVQNQQYY
QQSAAGSSGYVSAGSLYQQTAMPQQIFHTYTTSTNPSGHVEILSSTQTATQIYSHTSLPA
AGTVPVSSQSQYIPSAGGQVQTPIPSAIGVNNTSTMPHMQNVSTSTIPNIQNAPTLLGNP
QPQSQQNILVQMQYSQSTNVMPNSMSITPNMANISAQSSNNLQQQHQHFLSNVDQCPTTD
RSSLIKQDTMDSIQSLPPDLSINLPQDQITVPAPVVMSVAQQTVASNDGVTLENSESVPA
SERSRIKRSGTKRKKPGIKLTVLSVSSGEGQSMTVECQLDTSKQKTVTFKFDRDDMVPTD
IANNLVAENLLPQSQCETFIELIEDIVKQLRLDPTRTLPLVAHGPPDQSAGGSPVTSRRP
RDRDHSLDTAKQVRHGSLTRQSSHRSSYKVHRRHRSRDETSNTSTPTKLLPIDQIISHIA
NTTLEKQQVAQTPDSQAGAENTSAEASRRSSTSTQNTDTLTPTNIPSDPTDNQETVISAT
SAKTVVEAQNNIQDDANNSAFKSYQTFLTHAQTQIQDKTVSVGYASEVSKESQEHDVVDI
KESGITKEINTPIDISAEVSTLTVPTPMRKISRFLVSPVLEQKNIAADEESSTVGERVDC
MNVTTSQLASQPAAPTANVEQSIVKNEEHMEANVLEVQSVATLDSTSNNEMMVQNIPYVM
EQTDSTQQILQPGQQSIGLQQNIIQMQQVTGHVQQTTTIGQSKQHTIIVQGSTITSQQTS
QQIPQTSVQHFVPVNSQELQSQPLHSNGLVQTQAQYSNQAMMQPGVMMQPPQQQIPMQQG
IMQMHVQAEQMQPQRPAVQQFVPQQMQPPTQQYVILSGPMQPVQPITTMDDRNRRVSSLP
ATSNVQSSDSQISELSGITEEKRQVTNSSIPVTHMQHVQVVPQDISGTVPLSQNVVEATQ
PLHQNVQQVSGTLPPSMPVPVTTSVHPVVTATDTSAPKVAIKTKEISSTLPDLAQNLANI
LSNPKSKSTTPHSLANHEQPAAVSNVVAPASVDYKPVQSEQYFQPIQPETNQLQIQPPIQ
HNYQGQIVHQGYQGQQNFQQAFQNQPVLQQNQVQSIPQSIPVTIPPQQIDAQSQMVQSML
QNVSNQSTAPGKWIVTNQAPIQQPMRPNQPQPLPNQLQLQQISLQPQMHQQQIIQDQQHN
ESFVVNQLDQSHLHLKLPEQQPAKSLEIENPESSSLNCIRRISSDCQLITSENENSSHDV
TPEHTLVESIDSTSILQQQLSQSQQQQQLQHRKLSQQNSLDKMSDVNGVGNIGGGVGPQT
IADLHQKLVQVTSQPSESLNVGTPPISYPATPYNNQMVGGYDAYMHSLQQKLFNIGVPVS
SANAACPLSPQTTIHSSNILTDTQADTTIEGSIVTQDSSNAFALSQTNAECSLDSPIPGA
PVGSENMSPSKENVKIRAQRPGSRLQELEQELAKIHRGSVFAATIQPLTPPISAQTQNLL
TTAQSVSMIPVATVTPNIVTPRSGTNTPIQQTELQDATNEKTNPIQPTRKISRFVVSKVA
GPPVHSNAAINQHVDIGRSQLQTEELRTSERQNILSYTDDLHGISAQISHSRENSVPPVM
QATHGTNISNIEPEKEDRFVALTPSEEYQLLIKRQTLELETLQKRHREELERFQQHQLQL
LIQQQASALHHQHHPLLYHTVATNISGPRIPGTEDYLMFSTAPQTPLQKGSNNYPDTEET
LRLAMQKLKQTPLQLQPQQASAGIPHAYVIPIPVVPSESMQSVVSQQGNNCLNDVSEGID
MTYSTAVGNPTQYQFAPILSEGTNIPSTTGPLPASASLSISGATSAYIQYHESQPLPNFQ
TFTCTPHGGFFLPPGYRLIYTPPTTQSQPTTPATSHVTNSSRDDTPPTAELHHSTTAENS
TVPPSHSDQ
NT seq 9390 nt NT seq  +upstreamnt  +downstreamnt
atgccgagatgctacaatgacagcaagacagtgagttcagtgaacagcaactataagcac
ggtacagatgatattatattaacgcagtcgcatgctttctcgattggaagtcaattgaac
gtggacgaagatcccccagtagttgaaaagtcacatagacggttgcggtgtgacctaagt
cctgtcccaacaagtgcaaactctaatttaaacatcaagtttctcggtttaaagggtaat
aaaggtgttcgtcaagatcatcaggtgagcactggatctggggggcacagagaaagaaat
agggagattaaaaagagagcagctataggcaatacagtgcgtggattcttttcatctggc
cacagcaggcaggacaggtatgagacaaacaggcaacgttcttcaggtggaactggcggt
ggcttgtctagtttatgtcctaagctggtggccagtggaatctctgacggacaaagtggc
agtaatttgggagtgggccacttagcctctccggaaagcggagttgtccaaaggatccac
gcacacactcacagacgccaaagaaagctatctattgtcacacaggcaggtcctagtgcc
aacactactggtgataggaaggtattatccaatataagtcgctcggctaatatctctaaa
aagcaaattcgaatacagcgacacgatcaaagtactgattctttatctataactagcaac
ggtctcgcgactagttcgccatcttgtaaaaagaaagtactgtctgccttgcgtatctct
gatcgatcatctaccccaagtgtgaattcatcatcttttgatcatgaaaatgatcgtagt
ttcagtgatgctgaagaagcactcgcagcaacggagaatgcgtttacaacactaggttct
agttctataccttctacaccagttagtaaagcaaagtctgcaaaattgggcaagaatgag
gaagcaaatgtggaacatgttcctgtcgaatgtagcgattcgtcaaggaatgctgcggat
gtacaacacgtgattttaaatgagtttgaacaaaaaaatgttatgtcaataaagtcatct
gcagtacatgaattacacgcggttaatcaggaaagtattataaatgataagcaaaaatcg
tcgagttctacccttgatgccagatctattagtagtagtgaccaaaaagttctaaaacat
aaaaatataaattccgcagaaaaaatgattgaacatcataatagtaaagatattgaaaca
gccaatgtagaaagagatttaaacgataccacgatatcgatggaaatgaattccacagat
gatagtaatgaaggtaaacaaggaaaaaatagaaaatctgaagagtacatagatggcggt
gatgatacaaataaagaaattacagaccctttaaatgctgtaagcagcactaaggaggag
aagataacgagggtcaagagtaacgtaaatttaagcgaagaagtaattaagaattcgagg
tttgtaacatcaaaagtattggaggaggtaacggatgcagataccaagacagtggatgtg
gaaaaaggggaggaggaaagggtgacgatatacgatgacgatggcaccagtatcagcgac
atagtagcaacacaggcgcttcatgaatctttaagtaaattaggcaaagttccgccatta
gactccgagatagatgagaatacaactttgcgagacgaggcaaagatgagggaacattcc
gagaaagatgtagtcacgcaagaagaaacggcggaaggttttatcggtccgttactcgac
gaaaattttaaagcggatgagaaattgtcgcaaaaaacaatggcaatggaggaagtgcaa
aatttattaatgaaagttaaggtacagaccgtcgaagacgacgatgatgaagagaaagct
gtcggtatttcaccggacgggagatttttgaaatttgaagaagaaataggtcgtggcagt
ttcaagactgtttatcgcggattagatacccaaacgggtgtagctgtagcttggtgcgaa
ctgcaagagaaaaagttgaacaagacagagagattaagattcagggaagaagcagaaatg
ttaaagggattacaacatccgaatattgtaaggttttatgactattgggaagttacactt
acccgtaggaaatatattgtactagtcactgagcttatgacatcaggaacattaaaaacg
tatttaagaagatttaagaagattaatcccaaagtagtaaaatcttggtgtcggcaaatc
ttgaaaggcctgagctttcttcactctagatcaccacccattatacatcgtgatttgaaa
tgtgacaatatttttatcacgggtacaacgggaagcgtgaaaattggtgatttaggtctt
gcaacgttaaagaatcgtagttttgcaaagagtgttattggtacgccagaatttatggcg
cctgaaatgtatgaggagcattatgacgaatcggtcgatgtttatgccttcggaatgtgt
atgctcgagatggctactagtgagtatccatattcggaatgtacggggccagcacaaata
tacaaacgcgtagtgtcgggtgttaaaccgcagagctacgataaagtcgaaaatccggaa
gtacgtgatattatagaaatgtgtatacgtctgaagaaggaagaacgaccgctcgttaag
gacttacttaatcatgaatttttcgccgatgatgtcggattgaaattggagatggtttcg
cgagattcggcggtcgcggatactgagctgtcgcgtgttgagtttagattacgtgttctg
gatccaaagaaacgcagcaataagcacaaggaaaatgaagcgatacaatttgactttgac
atacaagctgataacgcggaagaagtagcgctagaaatggcaaaatctagccttatatta
gaggaagatgccaaagcagtggctaagatgttgaagtcgcaaattactactctactgcga
gaacgagaagatcgtaaagccaaagaagaaaaagaacgcttggatagagaaaacgctggt
acaactacagatgtcacagctaacgctgcaaacgctgagagcttgctacagcaacaactg
cttcttcagcagatgcaattacagcaacaacagcagcagcaacaacagcagcaaccacaa
attcaatctaatattaatatacagatgcaaaatccagtttcgatgcagttgccacaaact
caaatgcccattcagcaacagcaattacagtcgactgctcaacaagctccacaacataat
ttacaagcacaacaggttcagttggtccaacaacaaccgataatccaacagcaaacaccg
gtcgtgcagcctcaacaagcacagcaaatacaataccaacaacaaatacagcaacaatat
cagcagcaacaacagcaacagtatcctcagcacgtcccacagagtttgaatgcaaattct
ccgcaatgttcgactccgcaaaatcttcaagctcagcctcaatttccacaggtgcaacag
caacagcatgttcaccagcaacagcaatatatacaattgaatcagatgagcgttccacaa
cagattcctcatcagatgcaacaacagatgcagcctcaaatgcagatattgcctcaacaa
cagcacatgcatcaacagcttcaacaacagcaatacgtggcgcaaccgcaacttcagcat
gttcagcagctgcatcaacataccgttggttcgccgcccgttcagaatcagcaatattat
cagcagagcgctgctggctcttcgggatacgtatcagcggggtctttgtatcagcaaaca
gcaatgccgcaacaaatatttcacacttacactacgtctactaatccttctggtcacgta
gaaatcttatcgtctacccaaactgcgacgcagatttattctcatacgagtttacctgcc
gcgggtacggtgcccgtatcgtcgcagtcgcaatacattccgtcggcaggtggtcaggtt
cagacacctataccgtcggctataggtgtcaacaatacgtcaactatgccgcatatgcaa
aatgtttcgacttcaacgattcccaatatacagaatgcacccactttacttggcaatcca
cagcctcagtctcaacaaaatattctcgtgcaaatgcagtattcgcaaagcacaaatgtt
atgcccaattccatgtcgataacgcccaatatggcgaacatttcagcgcagtcgtccaac
aatctacagcagcaacatcaacattttctttcaaatgtggatcaatgtcctacaactgac
agatcttcattgataaaacaggatacaatggattcgatacagtctctgccgccagatcta
tcaattaatttaccgcaagatcaaattactgtacctgctccagtcgtaatgagcgttgca
cagcagactgtagcgtcaaacgatggagtcacactagaaaattccgagagcgttcctgct
tccgagagaagccggataaaacgttcaggaactaaacgtaagaaaccgggcattaaatta
acagtcttgtctgtcagtagtggtgaaggacaatcaatgactgtcgagtgccagttagat
acaagtaaacaaaagactgttacatttaaatttgatcgagacgatatggtaccaacggac
attgctaacaatttggttgctgaaaatctattgccgcaatctcaatgcgagactttcata
gaattaattgaagacattgttaaacaattgcgcttggatcctacgcgtactctgccttta
gtagcacatggcccgcccgatcagtctgctggtggaagcccggttacaagccgacgtcct
agggatcgcgatcacagtctcgatacagctaagcaggtgagacatggctcgctaacacgt
caaagtagccaccgatcgtcgtacaaagtccatcgtaggcaccgttcgagagacgaaact
tcaaatacttctactccaacgaaattattgccgatcgatcagattatttctcatatcgct
aataccactttggagaagcaacaagtcgctcagacccctgacagtcaagccggtgccgaa
aatacgtcagcggaagcttccaggagatcatccacatctacacaaaatacggacacatta
acacctacaaatataccgagtgacccaactgacaatcaagaaactgtcatttctgcaacg
tccgcgaaaacagttgtagaagcacagaataatattcaagatgatgctaataattcggcc
ttcaaatcttatcaaacatttttaacacatgctcagactcaaatacaagataaaacagtg
agcgtgggttatgcgagtgaggtatcgaaagaatctcaagagcatgacgtagtagatata
aaggaatctggaataactaaagagataaatacgcccatagatattagtgcggaggtatca
actttgaccgtaccgacgccaatgcgtaaaatttctcgctttttggttagtcctgtgctc
gaacaaaaaaatattgccgctgatgaggaatcttctaccgtcggcgaaagagtagattgt
atgaatgtcacgacgtcgcaactagcatcgcagcccgctgcgcctactgcgaatgtggaa
cagtctatagtgaaaaatgaagaacacatggaagcgaatgttttagaagttcagagtgtg
gcaactctggactcaactagcaataatgaaatgatggttcagaatattccgtatgtcatg
gagcagacagacagcacgcaacagatcttacagccgggacaacagtcgattggattgcag
cagaacattattcaaatgcaacaagtaacgggacacgtacaacaaaccacgactatcggg
caatcgaaacagcataccataatcgtccagggatctacgataacgtcacagcaaacctct
caacagatacctcagactagcgtgcagcatttcgtgccggtcaattcgcaggagttgcag
tctcaaccgctccattcgaacggattagttcagacgcaagcgcagtattcgaatcaagca
atgatgcaaccaggcgtgatgatgcaaccaccgcaacagcaaatccctatgcaacagggc
ataatgcagatgcacgtacaagcggaacagatgcaacctcagcgtccagcagtgcagcaa
tttgtcccgcaacagatgcaacctccgacgcagcagtacgttatactatcgggtcctatg
caaccggtacaaccgataacgacaatggacgatcgaaatcgcagagtgtcgagtttaccc
gctacgtctaatgtccaatcctcagactctcaaatttcggaattgtccggcataaccgaa
gaaaaaaggcaagttacaaactctagtatacctgtgacacacatgcaacatgtacaagtt
gttccacaagacatctccggtacagtgccattgtcacagaatgtcgtagaagccactcaa
cctcttcatcaaaacgtgcaacaagtttcgggaactttacctccatccatgccggtacct
gttactacttctgtgcatccggtcgtgaccgctaccgatacttctgcacctaaagttgcc
attaagacgaaagagatatcctcgacgcttccagatcttgcgcaaaatttagccaacata
ctttcgaatcccaagtccaaatctactacgcctcattctttggccaatcatgaacagcct
gctgctgtttctaatgtcgttgctcccgcgtcagttgattacaagcctgtgcagtccgaa
cagtattttcagcctatccaaccggagacgaatcagctgcaaattcaaccgcctattcaa
cataattatcaagggcagattgtgcatcagggatatcagggacaacagaactttcagcaa
gcgtttcaaaatcagccagtgcttcaacaaaatcaagtgcagtcgataccacaatcgatc
ccggtaacgattcctcctcaacagattgacgcgcagtcacagatggtgcaatctatgctt
caaaatgtgtcgaatcaatcgaccgctccaggaaagtggattgtaactaatcaagctccc
atacagcaaccgatgcgaccaaatcagccgcagccactcccaaatcaattgcagttacaa
caaatctctttgcagccacaaatgcatcaacaacagattattcaagaccaacagcacaat
gaatcttttgtcgtcaatcaattggatcaatcacatttacatttaaaacttccagaacag
cagccagcaaaatctttggaaattgagaatccggaatcatcgagtttaaattgtatacgt
cgtattagttccgattgtcagttaattacatcggaaaatgagaattccagtcacgatgtg
acgcctgagcacactcttgttgagtccatcgattctacatcgattctgcaacaacaattg
tcgcaatcgcagcaacagcaacagttacaacaccgaaaactcagtcaacagaattcattg
gacaaaatgtcagatgtaaatggcgtcggaaacatcggaggtggtgtaggaccgcaaact
atagctgatttacatcagaaacttgtacaagtgactagtcagccgtcggaatcgctgaat
gtcggtacaccacctataagttatcccgccacgccttataataatcaaatggttggagga
tatgacgcgtacatgcattctttgcagcagaaattgttcaatattggcgtgccagtttcg
tccgcgaatgccgcatgcccgttatctcctcaaacaacaatacattcctccaatattctc
accgatacgcaagccgacacgactatcgaaggttctattgtaacgcaggacagttctaac
gcatttgcactttcacaaactaatgcagaatgttctcttgacagtccaataccaggagct
cccgtagggtctgaaaatatgagcccaagtaaagaaaatgtaaagatacgagctcaaaga
ccgggatcccgtttacaggaactggagcaggaattggcgaagattcatagaggatcggtt
ttcgcagcgacgatccagccgttaacaccacctatatctgcacaaacgcaaaatttgttg
acgactgcacagtcagtgtctatgatacctgtggctactgttactcctaacattgtgaca
ccgcggtctggaaccaatactccaattcaacaaacagaacttcaagatgctactaacgag
aagacaaaccctattcaacctactagaaagatatcaagatttgtggtttctaaagttgct
ggcccacctgttcatagcaatgctgctattaatcaacacgttgatattggaagatctcaa
ttacaaacagaagaattaagaacgtcagaacggcaaaatattctgtcttatacagatgat
ctacatggtatatctgcacaaatatctcatagtcgagaaaattctgttccacctgttatg
caggcaactcatggtactaatatttcaaatattgaacctgaaaaagaagacagatttgtg
gctcttacaccgagtgaagaatatcaattacttataaagagacaaactttggaactagaa
acactgcaaaaaagacacagagaagagttggagcgtttccaacaacatcagctgcaattg
cttatacagcaacaagcaagcgcacttcaccatcagcatcatccgttgctctatcatacg
gttgcaacaaatatttctggacctagaattccaggaacagaggactatctgatgtttagt
acagcaccacagactccattgcagaaagggtcgaataattatccggacacggaagagact
ttacgactggccatgcagaaattgaagcaaactccgctgcagcttcaaccgcagcaggca
tcggctggaataccgcatgcttatgttattccaattccagtagtgccttctgaaagtatg
caaagtgtagtttctcagcagggtaataactgcttgaatgatgtatccgagggcatcgat
atgacttacagcacggcggttggaaatccgacgcagtaccaattcgctcctatattatca
gagggaacgaatatcccgtcgacaaccggaccgttacccgcgtccgcgtctctatcgata
tccggcgcgacaagcgcctacattcaatatcatgagagccagccgctaccgaattttcag
acttttacctgcactccccatggcggtttctttttgccacctggttatcgactgatatac
acgccgcccacaacgcaatctcagccgacaacacccgctacatctcacgtgacaaattct
tcgcgtgacgatacacctccgacggcggagctgcatcattcaaccaccgccgaaaattca
actgttcctccttcgcattcggatcaataa

DBGET integrated database retrieval system