KEGG   Monomorium pharaonis (pharaoh ant): 105834947Help
Entry
105834947         CDS       T05760                                 

Definition
(RefSeq) bumetanide-sensitive sodium-(potassium)-chloride cotransporter isoform X1
  KO
K10951  solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpha01009]
    105834947
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpha02000]
    105834947
Protein phosphatases and associated proteins [BR:mpha01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105834947
Transporters [BR:mpha02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   105834947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLC12 AA_permease AA_permease_N
Motif
Other DBs
NCBI-GeneID: 105834947
NCBI-ProteinID: XP_012533272
Position
Unknown
AA seq 1028 aa AA seqDB search
MYLQCICKGKLRQSKMENHFQGKTEDDMVGQLPQINKRPSMSLSMGGLWDVVPRLDHYRL
SRRAKRPSLSTLHEGNLIKDSNAVETGQVGSVVGQQGHGIKLGWIQGVLIPCLLNIWGVM
LFLRLSWVVAQAGILESIAIIGISAVVCVITTLSLSAISTNGEVKGGGIYFIISRSLGPE
FGASVGIVFAFANAVAASMNTIGFCDSLNDLLKTHHLKIIDNSVNDVRIVGTIALVVMIL
ICAVGMEWESKAQNFLIAVIVGAIFDFLIGTIIGPQTEEQKAKGFVGFSEQVFMNNLKPD
YRFSEKNNQSFFSVFAIFFPSVTGIQAGANISGDLKDPSSSIPMGTLLALLISMFSYVTF
VFFAGAAAVRDAGGFVNNTVVHCIPQINCTYGLHNSYSVMQLMSLWGPLIYAGCFAATLS
TALTNLLSVPRLIQALGQDRIYPGLIYFSKGYGKSGEPYRGYVLTLGVAALFLLIADLNA
VAPLISNFYLASYALINFCTFHAALIRPLGWRPTFKYYNTWLSLLGFILCVAIMFLIDWV
TSLVTFVIIFALYLIVVYRKPDVNWGSSTQAQTFKTAISIVYRLNSIDDHVKNYAPKILA
LTGPPAARPALIHLANLITKNNSLLIAGEVFSTRLSYRLRSVRLNNGYFWLQQQRIKSFY
HLVDDLSLERGAAALMQATGIGKLAPNVVLMGYKTHWSTCNHTDLQEYFNTLHNAFDNKL
AVAILRIAEGLDCSNVINGEDINGDDDHGVLAQSSYNLAGNTLMHADSNLSMSTQIPRVQ
SVPTMGTQFITPDTTPVIGYATVNWKAQENLKQKKRHVVDKLLERRNGGMAAIPENVTVF
QKKHKKGTIDVWWLYDDGGLTILLPYIISTRSNWKHCKMRIFALTNHKHDISAQEKEMVE
IMNKARINYSSLKIVDDIGVELKQETRTFFDKLISDFRINDSSENGECYITDNELQTLRD
KTHRQLRLRELLLENSSQSTLVVMSLPMPRKGAVSAPLYMAWLETLTRGMPPTILVRGNH
TSVLSFYS
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgcaatgtatttgcaaggggaagcttaggcaaagtaagatggagaatcatttt
caaggcaaaacggaagatgatatggttggacaattacctcaaattaataagagaccttca
atgtctctaagtatgggcggattatgggacgtagttccacgactagatcactacagatta
agtcgtcgtgcaaaaagaccgtctctaagcactcttcatgaaggaaatctcataaaggac
agcaacgctgtcgagaccggacaggtcgggagcgtcgtcggacagcagggtcacggaata
aaattaggatggatccaaggtgttcttatcccatgtctgctgaacatatggggcgttatg
ctgtttctgcgactctcgtgggtagtcgcacaagctggcattctagaaagcatcgccatt
attggaatatcggcggtcgtctgcgtcattacaacgcttagcctcagcgcaattagcact
aatggggaagtaaagggaggtggaatatattttatcatatctcgctctcttgggcccgaa
tttggtgcatcggttggcatcgtatttgcatttgcaaacgctgtagcggcttctatgaac
acgatcggtttctgtgattctctgaatgacttattaaagacacaccatttaaagatcata
gataatagcgtgaatgacgttagaatcgttggtacaatagcgctcgtcgttatgattctt
atctgtgcggtcggcatggaatgggaatcaaaggcacaaaacttccttatagctgtcatc
gtaggtgcgatctttgattttttaattggcactatcattggaccacaaactgaagaacag
aaagcaaaaggtttcgtaggattctctgagcaagtatttatgaataatctaaaaccagac
tatcgattttctgagaaaaacaatcaaagttttttctcggtgtttgccatcttctttcca
tcggttaccgggattcaagcgggcgctaatatatccggtgacctgaaggatccatcaagc
agcatacctatgggaacccttctcgctctgttaatctccatgtttagttatgtaactttc
gtcttttttgctggtgccgcagctgttagagacgcaggtggtttcgtcaacaacactgtt
gtgcactgcattcctcagattaactgcacgtacggactgcacaatagctactctgtcatg
caattaatgtcattgtggggtccattaatttacgcaggctgtttcgcagctactttatcg
acggcgctgacaaatttattgtcagtgccaagactcattcaggctttgggtcaagatcga
atttatcctggattgatttattttagcaagggatacggaaaatccggagaaccttatcga
ggatacgttcttacacttggcgttgcggctctcttccttttaattgctgatctcaacgca
gtcgcgccactcatctcaaatttctatttagcgtcgtacgctttaatcaacttctgcact
tttcatgcagcattgattcgaccccttggatggcggcctacttttaaatattacaatact
tggctgtctttgcttggttttattctttgcgtggcgattatgttcctcattgattgggtg
acttcacttgttaccttcgttatcatcttcgcgctatatttaatagtagtttaccgtaaa
ccagatgtgaattggggtagcagcacacaggcgcaaacttttaagactgcaatttccatt
gtctacaggttgaattctattgacgatcatgtgaagaattacgctcctaaaattttggca
ctaacgggtccgcctgctgcaagacccgcattgatacatttagcgaatctcatcacaaag
aataattcgttgctgattgctggcgaagtcttttcgacacggctatcgtatcgactacgc
tccgtacgtctaaataatggttacttctggctgcaacagcaacgtattaaatcattttac
catttggtggatgacttgagtttagaacgaggtgctgctgcgctgatgcaggctactgga
attggcaagttagctcctaatgtagtccttatgggttataagactcattggtcgacatgt
aatcatacagacctgcaagaatattttaatactcttcacaatgcttttgataacaaattg
gctgtagcaatcttaagaattgccgaaggtctggattgctccaacgtcattaatggagaa
gacataaacggagatgatgatcatggagttctcgcgcagagtagttataatttggcggga
aacactttaatgcacgctgatagcaatctatctatgagcacgcagattcctagagtacaa
agtgtgccaacaatgggtactcaatttattacacccgatacgacacctgtaatcggatat
gcaactgtaaattggaaagctcaagaaaatttaaaacaaaagaaaagacatgttgttgat
aagctgctcgagagacgaaatggtggtatggctgctataccagaaaatgtgacagttttc
caaaagaagcacaaaaaaggaacaattgacgtgtggtggctatatgatgatggaggtttg
acaattctcttaccgtatataatcagcacacgctcaaattggaagcactgcaagatgaga
atatttgctttgaccaatcataaacatgatatcagcgcccaagaaaaagaaatggtcgag
ataatgaacaaggcacgaattaactacagtagtttaaagatagtagatgacattggcgtc
gaactaaaacaggaaacacggactttctttgacaaattaatatctgattttcgaataaac
gattcttccgaaaatggtgaatgttatattactgataacgagcttcagactttacgagat
aaaacgcatcgacaattacgactgcgagaattattactggaaaactcaagtcaatccacc
ttggtagttatgtctttaccaatgccaagaaaaggggcagtttcagcgccattatacatg
gcctggttggagacacttacgaggggtatgccacccacaattttagttcgtggaaaccac
acatctgtattatcattttattcgtag

DBGET integrated database retrieval system