KEGG   Monomorium pharaonis (pharaoh ant): 105835735Help
Entry
105835735         CDS       T05760                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00051  Fructose and mannose metabolism
mpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105835735
Enzymes [BR:mpha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     105835735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N BLF1
Motif
Other DBs
NCBI-GeneID: 105835735
NCBI-ProteinID: XP_012534716
Position
Unknown
AA seq 452 aa AA seqDB search
MNIANMKNIKIIAVDVKDIRFPTSLNRDGSDAMHTDPDYSCVYVTIKTNKKEYEGYGLTF
TLGRGTEIVAQACKSLGCIVLYRKLKWIYSNFGTFWRRLTSDSQLRWVGPEKGVIHLATA
AITNALWDLWARIEGKPVWKLLSDMSPDELVSVIDFRYITDVVNEQTARRILEDKQELRQ
EQEKKLLENGYPAYTTQVGWLGYSDRQLEDLCEKFLNLGYTAFKIKVGQNLQDDIRRCEA
IRRVIGYKNKLMLDANQVWDVNEAIEWMEKLAKFEPTWIEEPTSPDDIYGHAEILSKLRP
HGIGVATGEMCANRVMFKQFLKSHAISYCQVDSARIGGINEILAVYLMAYITKIPVCPHA
GGIGLCEMVQHLQMWDYICLSQTTENRIIEFVDQQHEHFMDPVCIRNACYMPPMHPGYST
KLKEESIREYVYPEGTRWKNKIVEEKETEESD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgccaatatgaaaaacatcaaaatcatcgctgtcgatgtgaaagatataaga
tttccgacatcgttaaatcgcgatgggagcgatgcaatgcatactgatcccgattattct
tgcgtatatgtaacaattaaaaccaataaaaaagaatatgaaggatatggtcttacgttt
accctgggaagaggaactgaaattgttgcgcaagcatgcaagtctttaggctgcatcgta
ttgtatcgaaaattaaaatggatctacagtaattttgggacgttctggagacgtttaacg
agtgactcgcaattaagatgggtcggaccagagaaaggcgtaatacatctagctacagca
gctattacaaacgcattgtgggacttgtgggcgcgtatcgagggcaaacctgtttggaag
cttctttcagacatgtcaccagacgaacttgtttccgttatagatttcagatacattaca
gacgtagtgaacgagcaaaccgcgagaagaatactcgaggataaacaggaacttaggcaa
gagcaagagaagaaactgctggagaatggatatcctgcgtacaccacacaggtcgggtgg
ctaggttacagtgatcgacagcttgaggatctctgcgagaagttcttgaacctcggttac
acggcgttcaagatcaaagtgggccagaatctgcaggatgacattaggagatgcgaggcg
atacgcagagtaataggctacaagaacaaattaatgctggacgcgaaccaggtctgggat
gtgaatgaagcaatcgagtggatggagaagctggcaaaattcgaacccacttggatagaa
gaaccgacctctcccgacgatatttatggacatgccgagatactcagcaagttaagaccg
catggtatcggggtggccaccggcgagatgtgtgcaaatcgcgttatgttcaagcaattc
ctgaaatcccacgcaattagttattgtcaagtcgattcggcaaggattggtgggattaac
gagattttggctgtatacctaatggcatacataactaaaataccagtttgcccacatgct
ggtggaataggcttatgcgagatggttcagcatcttcaaatgtgggattacatttgcttg
agtcagaccaccgaaaatcgtataatagaatttgtggatcaacagcatgaacactttatg
gatcctgtttgcatcaggaatgcatgttacatgccacccatgcatcccggatactcgact
aaacttaaggaagagagcatcagagaatatgtttatccagaaggcactcgatggaaaaat
aagattgtcgaagaaaaagaaaccgaggaaagcgattaa

DBGET integrated database retrieval system