KEGG   Monomorium pharaonis (pharaoh ant): 105836918Help
Entry
105836918         CDS       T05760                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00010  Glycolysis / Gluconeogenesis
mpha00562  Inositol phosphate metabolism
mpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105836918
   00562 Inositol phosphate metabolism
    105836918
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105836918
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105836918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4112
Motif
Other DBs
NCBI-GeneID: 105836918
NCBI-ProteinID: XP_012536739
Position
Unknown
AA seq 478 aa AA seqDB search
MSALSLLLLAASLLASPSVRVLARDVDFCFADEDDPYLYLATKTAYHFVHGGKTRFQTVP
NCRPVQIWMLAAHGTRCPNTQEIQNIRSLNDLKDQILQNHEARKEGHMCNRDLENLRRWK
LDDYLLPQRAEILTPQGVEDMKLLARRLQSNFPELLLPDRHNITSTNYKFRATEARDSMT
SFMEGLFGSRSAVLPEETSLNDTLLSAYKTCGVWNNEEKDGSFENVERNRFDNGPEFQNL
QKNVSRRLGFLYNISADKIDAMYDACRYQKAWSVTELSPWCAVFSKEELRVLEYREDLEY
YYKAGYGRDINTRLGCPLLHDMMRHFWNIARDEMVNEPAGIFYFSDIVSLQNLLATMGIN
EDQMRLTAYNYKDMARRQWRTSMISPFAGNLIAVFYKCNDRNNRNKVMFYLSEKPVRYSG
CQVGLCDWEFLKSQFGQLASNCKLDVCWKASGAISNFPNSIAILLMSFVLVLLGYKQL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgttgtcgttgctgctgctggccgcgtcgctcctggcatccccgagcgtccgc
gtgctcgcgcgcgacgttgacttctgcttcgcggacgaggatgacccgtacctgtacctg
gccacgaagaccgcgtaccacttcgttcacggcggcaagacccggttccagacggtgccg
aattgccgaccggtgcaaatctggatgctcgcggcacacggcacccgttgcccgaacacg
caggaaatccagaacatccgctccttaaacgatctcaaagaccagatacttcagaatcat
gaagcgcgcaaagagggtcacatgtgcaatcgagatctcgagaacctacgaagatggaag
ctggacgattatttgttgccacaacgggcggaaatcctgacgccacaaggggtggaggac
atgaagctgctggcaagaaggttgcagagcaatttcccagagctgttgcttcccgatcgt
cacaacatcacatccaccaattacaagttccgtgctaccgaagctcgtgacagcatgaca
tctttcatggaaggcctatttggtagcagatccgccgtgctaccggaagagacttccctc
aacgacactttacttagcgcgtacaaaacatgcggcgtgtggaataacgaagagaaagat
gggtcattcgagaatgtagaacggaacagattcgacaatggaccggagttccaaaatctt
cagaagaacgtcagcaggcggcttggttttctgtacaatatttctgctgataagatcgac
gctatgtacgacgcgtgtcgataccagaaggcctggtcggtcaccgaactctcaccctgg
tgcgccgtcttcagcaaggaggagcttcgcgttctggagtacagggaagacctcgaatac
tattataaggcgggctatgggcgagatatcaacactcgtttgggatgtcctctgttgcac
gatatgatgcgacatttctggaatatagcgcgtgacgagatggtgaacgagcccgcgggc
atcttctacttcagcgacatcgtcagcctgcaaaatcttctggccacgatgggcataaat
gaggatcaaatgcgattgaccgcctataattacaaagacatggccagacgccaatggcgc
acatcgatgatatcgcccttcgccgggaatctcatcgcggtgttttacaaatgcaacgac
agaaataaccgcaacaaggtaatgttttacttgtcggagaaaccagtacgatacagtggc
tgtcaagtcggtctttgcgattgggagttcctgaagagccagttcggccaattggcgtcc
aattgcaagctggacgtctgctggaaggcgagcggagcaatctccaactttcctaattcc
atagccatcctattaatgtcctttgttctagtcctcctcggctacaaacagttgtaa

DBGET integrated database retrieval system