KEGG   Monomorium pharaonis (pharaoh ant): 105837866Help
Entry
105837866         CDS       T05760                                 

Definition
(RefSeq) uncharacterized protein LOC105837866 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00260  Glycine, serine and threonine metabolism
mpha01100  Metabolic pathways
mpha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105837866
Enzymes [BR:mpha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     105837866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 105837866
NCBI-ProteinID: XP_012538466
Position
Unknown
AA seq 380 aa AA seqDB search
MSYGGVNENIHNYAREKNAIIVDLRSDTLTKPTAEMRKAMYEAQVGDDVYEEDPTVKELQ
KKAADLLGKEDALFVSSGTMGNLIAVMNHCDVRGSEVYCGDESHVFLHEQGGAAQIAGVS
LNVLPNNNDGTFDLKSLESAIRTDRIHEPISKLIMVENTINGKVVPQSWIEELSMVARKH
NLKMHLDGARLWNASVASKISAKDLVAPFDSVTFCLSKGLGAPIGSVLCGSKSFIADARR
RRKVLGGAMRQVGVIAAAGIVALEQTVPRLAEDHRRALHIAEAINQLNSKIFNIDLKTTH
TNMIFVNVNTDSGISAETLMNRLQEVNTFDEDDKIIIQCLALTKRLMRLVLYYDINDTMV
TAAIRKLRYVIKQLDPQVKI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacggcggagtaaatgaaaacattcacaattatgcgagggaaaaaaatgctatt
atcgtcgatctacgaagcgacacgcttacgaaaccgacagcggagatgaggaaagctatg
tacgaggcgcaagtaggggatgacgtctacgaggaagatccaacggtaaaagaattacaa
aaaaaggctgcagatttgcttggaaaggaagatgcactttttgttagttctggtacgatg
ggaaatttgatcgctgtcatgaaccattgcgatgtgcgaggcagtgaagtctactgtggg
gatgagtcacatgtctttcttcacgaacagggtggtgcggcgcagatagccggcgttagt
ctcaatgtcctgcctaacaacaacgacggtacgttcgatctaaagagtctcgagagcgca
attcgcacggaccgaatacacgaaccgatatcaaagctgatcatggtggagaacacgata
aacggaaaagtcgtacctcagtcatggatcgaagaattatcgatggtagcgaggaagcat
aatcttaagatgcatttagatggggcacgattgtggaacgcctcggttgcatcgaagatc
tcggcgaaggatttggtcgctccgttcgactctgttactttttgcttgagcaaaggactg
ggcgctcctatagggtccgtgctttgcggaagcaagagtttcatcgctgatgcaaggagg
aggcgcaaggtgttgggtggcgccatgcgacaggtcggcgtaatcgccgcggctggaatc
gtcgccttggaacagacagtgccacggctagcagaggatcacagaagagcgttgcacatt
gcggaggcgatcaatcagttgaactctaagatattcaacatagatctgaaaaccacacat
accaacatgatattcgtgaacgtgaatacagatagcggcatttcagccgaaactctcatg
aacagactccaggaagtgaatactttcgatgaagacgacaagatcataattcaatgtcta
gctctcacgaaaagattgatgagactagttctctattatgatatcaacgatacgatggtg
actgctgccattcgtaaattaagatacgtcatcaagcaattggatccccaagtaaagatt
tga

DBGET integrated database retrieval system