KEGG   Monomorium pharaonis (pharaoh ant): 105837888Help
Entry
105837888         CDS       T05760                                 

Definition
(RefSeq) stress-activated protein kinase JNK isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04013  MAPK signaling pathway - fly
mpha04068  FoxO signaling pathway
mpha04137  Mitophagy - animal
mpha04140  Autophagy - animal
mpha04141  Protein processing in endoplasmic reticulum
mpha04214  Apoptosis - fly
mpha04215  Apoptosis - multiple species
mpha04310  Wnt signaling pathway
mpha04391  Hippo signaling pathway - fly
mpha04624  Toll and Imd signaling pathway
mpha04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105837888
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105837888
   04310 Wnt signaling pathway
    105837888
   04391 Hippo signaling pathway - fly
    105837888
   04068 FoxO signaling pathway
    105837888
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105837888
   04137 Mitophagy - animal
    105837888
  09143 Cell growth and death
   04214 Apoptosis - fly
    105837888
   04215 Apoptosis - multiple species
    105837888
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    105837888
  09158 Development and regeneration
   04361 Axon regeneration
    105837888
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105837888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpha01001]
    105837888
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105837888
Protein kinases [BR:mpha01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105837888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 105837888
NCBI-ProteinID: XP_012538503
Position
Unknown
AA seq 388 aa AA seqDB search
MATNATESSNVRSGYRRHVFGDTELCIPERYVDVVPRGVGAQGIVCAAYDTVTAQNVAIK
KLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRSLDEFQDVYLVMELMDANL
CQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLART
AGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWN
KIIEQLGTPAQEFMQRLQPTVRNYVENRPRYPGYPFERLFPDVLFPSDSSEHNRLKASQA
RDLLSRMLVIDPERRISVDEALLHNYINVWYDEGEVNAPAPGPYDHSVDEREHTVDQWKE
LIYQEVMEYETSHNPAAVAQSSESAGSR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaacgcgacggaatcgagcaacgttcggagcggctatcgtcgtcacgttttc
ggcgacaccgagctttgcatacccgaaagatacgtcgacgtcgtaccgcgtggcgtcggc
gctcagggtatcgtctgtgcggcgtacgataccgtcactgcgcaaaatgtggcaatcaag
aagctgtccagaccttttcaaaacgtgacgcacgcgaagagggcctacagagagttcaag
ctcatgaaactggtcaatcacaaaaacataatcggtctcctgaacgcgttcacgccgcaa
cggtcgctggacgagtttcaagacgtgtatttggtgatggagctcatggacgcgaacctt
tgccaggtgatccagatggatctggatcacgagcgcatgtcgtacctcctctatcagatg
ctgtgcggcatcaagcatttgcactccgctggcattatacacagggatctaaagccaagc
aatattgttgtaaaatctgactgcacgctgaagattctcgactttggcttggcgaggacc
gctggtaccacattcatgatgacgccctacgtcgtcacgcggtattaccgggcgccagag
gtgattctgggcatgggatacaaggagaatgtagatatctggtcggtaggctgcatcatg
ggcgagatgatacgcggtggtgtactgttccctggtacggatcacatcgatcagtggaat
aaaataatcgagcaacttggcacaccggcgcaggaatttatgcaacgactgcagcctacc
gtcagaaattacgtggagaacaggccacgatatccaggctatcccttcgagaggctattt
ccggacgtcctattcccctcggactcctcggaacacaatagattaaaagcgagccaagcc
agggatctattgtcgcgcatgctcgtgatcgacccggaacgacgcatctccgtggacgag
gcgttgctgcacaattacataaacgtctggtatgacgagggggaagtcaatgctcccgca
cctggtccatatgaccatagtgtagacgagagggaacacacggtggatcagtggaaggag
ctaatttatcaagaagtgatggagtacgaaacaagtcacaatcccgcggcggttgctcag
tcgtcagagagcgctgggagccggtag

DBGET integrated database retrieval system