KEGG   Monomorium pharaonis (pharaoh ant): 105840045Help
Entry
105840045         CDS       T05760                                 

Definition
(RefSeq) myotubularin-related protein 2 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00562  Inositol phosphate metabolism
mpha01100  Metabolic pathways
mpha04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105840045
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105840045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpha01009]
    105840045
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     105840045
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     105840045
Protein phosphatases and associated proteins [BR:mpha01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    105840045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 Mem_trans
Motif
Other DBs
NCBI-GeneID: 105840045
NCBI-ProteinID: XP_012542231
Position
Unknown
AA seq 706 aa AA seqDB search
MIKRTRTLLGVAWHDSLLIPVISLNSFFVINEAGNNNVIATNVKNFRTFFNASMEKRGSA
ELLSTEQSNSKNASSDSLNSDSKSSSLNSKMGQESESWEKASHSKSFSSSSTSTDNNIVS
ALETKKDNQVKNLSGGDTGPPLLNGERVQGIAHEVTYLCPYSGPARGILSVTNYKLHFRS
IDRETPYVVEVPLGVVSRIEKVGGASSRGENSYGIEVFCKDMRNLRFAHKQENHSRRDVF
EKLQQYSFPLSHKLPLFAFEYSETFSENGWNVYEPIAELKRMGVNNDMWKISKINDTYSL
CDSYPAVWAVPAAATDEDLQASASFRSRGRLPVLSWIHPESQATITRCAQPLVGVGGKRS
REDERYVQLIMDANAQSHKLFIMDARPMPNAIANKAKGGGYESEDAYQNAELVFLDIHNI
HVMRESLRKLKELCFPTIDEARWLSGIESTMWLKHIKCVLAGAVRIVDKVENHKTSVLVH
CSDGWDRTAQLTALAMLMLDPYYRTVKGFEVLIEKEWLSFGHKFQQRIGHGDEHHSDADR
SPVFLQFIDCVWQIMRQFPNAFEFNEHFLITILDHLYSCRFGTFLFSSERERVQEQVKQR
TVSLWSYTNSQLPLYLNPLYRSGTNYQLVLMPVASMRYIKPWKSLYCRWNPSMRQQDPVY
QRTRELLVLKEQLEKQLEEGRREQASRANRSITSSAPPRIHSPVHI
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcgaacccgtacacttctgggcgtggcatggcatgattcgcttctgattccg
gtcatatccttaaattctttttttgtcataaatgaagctggaaacaataatgttattgca
acaaacgtaaagaattttcgaactttctttaatgcaagtatggaaaaaagaggcagtgca
gaactcctgagtacagaacagagcaattcgaagaatgccagttcagattcactcaactca
gatagcaagagcagttcgcttaattcgaagatgggtcaggaatcggagagttgggagaaa
gcttcacattcaaaaagtttttcttcgagctccacttcaacagataataacatagtctct
gctttagagactaaaaaagataatcaagtaaaaaatttgtctggaggggatacgggacca
ccgctcttgaatggagaacgagtgcaaggcattgcgcacgaagttacctatttgtgtcct
tattcgggacctgccagagggatcttaagtgttacaaactacaaacttcactttcgtagt
atagatcgagaaacgccttatgttgtggaagtgccgttgggggtcgtcagtcgaattgaa
aaagttggcggtgcatcgagtagaggagagaattcctatggaattgaagtattttgtaag
gatatgaggaatctcagatttgctcataagcaggagaaccattccagacgagacgtattc
gagaaactacaacagtattcttttccattatctcacaagttacctctctttgcctttgaa
tactctgagaccttttctgaaaatggttggaatgtttacgaacctattgcagaattaaag
aggatgggtgtaaataacgatatgtggaaaatatccaaaatcaatgacacgtattcgctg
tgcgacagttatccagctgtctgggcagtgcctgccgcagcgaccgacgaagatctccaa
gcctccgcatcgtttagaagtagaggtagacttccggttctttcatggattcatccggaa
agccaagcgacgataactcgttgcgctcagccattagtaggcgttgggggcaaacgaagt
cgcgaggatgaaaggtatgtccagctgataatggacgctaacgcacaaagtcacaaactc
tttattatggatgcgcgaccgatgccaaatgcgatagcaaacaaagctaaaggtggtgga
tatgaaagcgaagatgcgtatcaaaacgcggaattggtctttcttgacattcacaatata
catgtcatgcgagaaagtctcagaaaattaaaagaattgtgttttcccacaattgacgaa
gctcgatggttgtcgggcatagaatcaacaatgtggcttaaacatatcaaatgtgttctc
gctggagctgtaagaattgtggacaaagtcgaaaatcataagacttccgtcttagttcac
tgttctgacggttgggatcgaacagcccaacttacagctctggcaatgttaatgttagat
ccatattatagaacagtcaagggatttgaggttctaatagaaaaagagtggcttagcttt
gggcataaatttcaacagaggataggccatggtgatgaacaccatagtgatgcagataga
tcgccagtatttttacaatttattgattgtgtttggcaaataatgcggcaatttcccaat
gctttcgaattcaacgaacattttctgattactattctcgatcatctttactcttgcaga
tttggcacattcttgttcagcagcgaacgtgaaagagtccaagagcaagtgaaacaaaga
acagtctccctctggtcttatactaatagtcaattacctctttatctgaatcctctttat
cggtctggtacaaactatcaacttgttttaatgccagttgctagtatgcggtatatcaaa
ccttggaagagtctatattgtagatggaaccccagtatgcgacaacaggatcctgtttat
caaagaacaagggagcttctagtcttgaaagagcagcttgaaaagcagctggaggaaggt
agacgtgaacaggcctcacgtgcgaatcgatccattacctcatcggcgccacccagaata
cattccccagttcacatatag

DBGET integrated database retrieval system