KEGG   Mycolicibacterium phlei: MPHLCCUG_00533Help
Entry
MPHLCCUG_00533    CDS       T04305                                 

Gene name
fadA_1
Definition
(GenBank) Putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00071  Fatty acid degradation
mphl00072  Synthesis and degradation of ketone bodies
mphl00280  Valine, leucine and isoleucine degradation
mphl00310  Lysine degradation
mphl00362  Benzoate degradation
mphl00380  Tryptophan metabolism
mphl00620  Pyruvate metabolism
mphl00630  Glyoxylate and dicarboxylate metabolism
mphl00640  Propanoate metabolism
mphl00650  Butanoate metabolism
mphl00900  Terpenoid backbone biosynthesis
mphl01100  Metabolic pathways
mphl01110  Biosynthesis of secondary metabolites
mphl01120  Microbial metabolism in diverse environments
mphl01130  Biosynthesis of antibiotics
mphl01200  Carbon metabolism
mphl01212  Fatty acid metabolism
mphl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mphl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPHLCCUG_00533 (fadA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    MPHLCCUG_00533 (fadA_1)
   00640 Propanoate metabolism
    MPHLCCUG_00533 (fadA_1)
   00650 Butanoate metabolism
    MPHLCCUG_00533 (fadA_1)
  Lipid metabolism
   00071 Fatty acid degradation
    MPHLCCUG_00533 (fadA_1)
   00072 Synthesis and degradation of ketone bodies
    MPHLCCUG_00533 (fadA_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MPHLCCUG_00533 (fadA_1)
   00310 Lysine degradation
    MPHLCCUG_00533 (fadA_1)
   00380 Tryptophan metabolism
    MPHLCCUG_00533 (fadA_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MPHLCCUG_00533 (fadA_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MPHLCCUG_00533 (fadA_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MPHLCCUG_00533 (fadA_1)
Enzymes [BR:mphl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MPHLCCUG_00533 (fadA_1)
Exosome [BR:mphl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPHLCCUG_00533 (fadA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMO59371
Position
complement(523080..524243)
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPNEVEQVIGGCVTQYG
EQSNNISRVAWLTAGLPDHVGATTIDCQCGSAQQANHLIAGLIATGAIDVGIACGIEAMS
RVGLGENAGPDRSKIRAASWDIDMPNQFEAAERIAKRRGITREEIDQFGLQSQLKAQRAW
AEGRFDREISPIEAPVLDEQKQPTAERHMVSRDQGLRETTLEGLAALKPVIEGGIHTAGT
ASQISDGAAAVLWMDEDKAKALGLKPRARIVAQANVGAEPYYHLDGPVQSTERVLQKAGM
KMGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGSTGARLITTALHEL
ERTDKSTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccctgtcatcgttgaagccactcgcagtcccatcggtaagcgcaacggctgg
ctgtccggcctgcacgcgaccgagttgctgggcgcggtgcagaaggctctggtcgagaag
gcgggcatcgaccccaatgaggtcgagcaggtcatcggcggctgcgtcacgcagtacggc
gagcagtccaacaacatcagccgcgtcgcctggctgaccgccggactgcccgaccacgtc
ggcgccaccaccatcgactgccagtgcggcagcgcccagcaggccaaccatctgatcgcc
gggctgatcgcgaccggcgcgatcgacgtgggcatcgcctgcggcatcgaggcgatgagc
cgcgtcggcctgggcgagaacgccggcccggaccgctccaagatccgcgccgcgtcctgg
gacatcgacatgcccaaccagttcgaggccgccgagcggatcgccaagcggcgcggcatc
acccgcgaggagatcgaccagttcggtctgcagtcgcaactgaaggcgcagcgggcgtgg
gccgagggccgcttcgaccgggagatcagcccgatcgaggcgccggtgctcgacgaacag
aagcagccgacggccgagcgtcacatggtcagccgcgaccagggcctgcgcgagaccacg
ctggaggggctggccgcgctcaagccggtgatcgagggcggcatccacaccgcgggcacc
gcgtcgcagatctccgacggcgccgccgcggtgctgtggatggacgaggacaaggccaag
gccctgggtctgaaaccgcgcgcccggatcgtggcgcaggccaacgtcggcgccgagccc
tactaccacctcgacggtccggtgcagtccaccgagcgggtgctgcagaaggccggcatg
aagatgggcgacatcgacatcgtcgagatcaacgaggcgttcgcctcggtcgtgctgtcg
tgggcccgggtgcacgagccggacatggaccgggtcaacgtcaacggcggcgcgatcgcg
ctcggccatccggtcggcagcaccggcgcgcggctgatcaccaccgcgctgcacgagttg
gagcgcaccgacaagagcaccgcgctgatcacgatgtgcgcaggcggcgcgctgtccacc
ggcacgatcatcgaacggatctag

DBGET integrated database retrieval system