KEGG   Mycolicibacterium phlei: MPHLCCUG_02934Help
Entry
MPHLCCUG_02934    CDS       T04305                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00770  Pantothenate and CoA biosynthesis
mphl01100  Metabolic pathways
Module
mphl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MPHLCCUG_02934 (coaBC)
Enzymes [BR:mphl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     MPHLCCUG_02934 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     MPHLCCUG_02934 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N Glyco_transf_4 PspC Imm61
Motif
Other DBs
NCBI-ProteinID: AMO61743
Position
complement(2996086..2997333)
Genome map
AA seq 415 aa AA seqDB search
MEPKRIIVGVAGGIAAYKAATVVRQLTEAGHDVRVIPTESALKFVGAATFEALSGNPVHT
GVWDDVHEVPHVRLGQQADLVVVAPATADLMARAVAGRADDLLTATLLTARCPVLFAPAM
HTEMWLHPATVDNVATLRRRGAVVLEPASGRLTGADSGAGRLPEPEEIATLAQLLLERPD
ALPYDMAGLKVLVTAGGTREPIDPVRFIGNRSSGKQGYALARVLAQRGAEVTLIAGNTVG
LADPASVHVERVGSAAQLKDAVSKHAPESHVLVMAAAVADFRPLHVQTSKIKKSADPDAA
APVIELTRTDDVLAGVVRARAERQLPNMRAIVGFAAETGDANGDVLHHARAKLKRKGCDL
LVVNAVGEGRAFEVDHNDGWLLAADGAESALEHGSKTLMASRIVDAIEAFLQSGG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaagcggatcatcgtcggcgtcgccggtggcatcgcggcctacaaggcggcg
accgtggtccggcagctcaccgaggccggtcatgacgtccgggtcatcccgaccgagtcg
gcgctgaagttcgtcggcgcggccaccttcgaggccctctccggcaatcccgtgcacacc
ggggtgtgggacgacgtgcacgaggtgccgcacgtccgcctcggccagcaggccgacctc
gtcgtcgtcgcacccgccaccgcggacctgatggcccgcgccgtcgccggccgcgccgac
gacctgctgaccgccacgctgctcaccgcgcgatgtccggtgctgttcgcaccggcgatg
cacaccgagatgtggctgcacccggcgaccgtggacaacgtcgccaccctgcgccgccga
ggcgcggtcgtgctcgaacccgcgtccggccgcctgaccggcgccgacagcggcgccggc
cgcctgcccgagcccgaagagatcgccaccctggcccagttgctgctcgagcgccccgac
gccctgccctatgacatggccgggctcaaggtgctcgtcaccgccggcggcacccgcgaa
cccatcgacccggtccggttcatcggcaaccgcagctccggcaagcagggctacgcgctg
gcccgggtgctggcccagcgcggcgccgaggtcacgctgatcgccggcaacaccgtggga
ctcgccgatccggccagcgtccacgtcgaacgcgtcggctcggccgcccagctcaaggac
gcggtctccaaacacgcccccgagtcgcacgtgctggtgatggccgccgcggtggccgac
ttccgcccgctgcacgtgcagaccagcaagatcaagaaatccgcagaccccgacgccgcg
gccccggtcatcgagttgacccgcaccgacgacgtgctggccggggtggtgcgggcgcgc
gcggagaggcaactgccgaacatgcgcgcgatcgtcgggttcgccgccgagaccggcgac
gccaacggcgacgtcctgcaccacgcccgcgccaagctgaagcgcaagggatgtgatttg
ctagtcgtcaatgcggtgggggagggccgtgcgttcgaggtggaccacaacgacggctgg
ctgctggcggccgacggcgcggagtccgcgttggagcacggttcgaagacactgatggcc
agccgtatcgtggacgcgatcgaggccttcctgcagagcggcgggtaa

DBGET integrated database retrieval system