KEGG   Mycolicibacterium phlei: MPHLCCUG_04267Help
Entry
MPHLCCUG_04267    CDS       T04305                                 

Gene name
fadA_7
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00071  Fatty acid degradation
mphl00072  Synthesis and degradation of ketone bodies
mphl00280  Valine, leucine and isoleucine degradation
mphl00310  Lysine degradation
mphl00362  Benzoate degradation
mphl00380  Tryptophan metabolism
mphl00620  Pyruvate metabolism
mphl00630  Glyoxylate and dicarboxylate metabolism
mphl00640  Propanoate metabolism
mphl00650  Butanoate metabolism
mphl00900  Terpenoid backbone biosynthesis
mphl01100  Metabolic pathways
mphl01110  Biosynthesis of secondary metabolites
mphl01120  Microbial metabolism in diverse environments
mphl01130  Biosynthesis of antibiotics
mphl01200  Carbon metabolism
mphl01212  Fatty acid metabolism
mphl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPHLCCUG_04267 (fadA_7)
   00630 Glyoxylate and dicarboxylate metabolism
    MPHLCCUG_04267 (fadA_7)
   00640 Propanoate metabolism
    MPHLCCUG_04267 (fadA_7)
   00650 Butanoate metabolism
    MPHLCCUG_04267 (fadA_7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MPHLCCUG_04267 (fadA_7)
   00072 Synthesis and degradation of ketone bodies
    MPHLCCUG_04267 (fadA_7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MPHLCCUG_04267 (fadA_7)
   00310 Lysine degradation
    MPHLCCUG_04267 (fadA_7)
   00380 Tryptophan metabolism
    MPHLCCUG_04267 (fadA_7)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MPHLCCUG_04267 (fadA_7)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MPHLCCUG_04267 (fadA_7)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MPHLCCUG_04267 (fadA_7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mphl04147]
    MPHLCCUG_04267 (fadA_7)
Enzymes [BR:mphl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MPHLCCUG_04267 (fadA_7)
Exosome [BR:mphl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPHLCCUG_04267 (fadA_7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AMO63055
Position
4361370..4362587
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVATARSPIGRAAKGSLVDMRPDDLAAQMVRAVLDKVPALDPREIDDLIMGCGQP
AGEAGFNIGRAVAVQLGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGHAFISAGVETV
SRFPKGTADGWPDTKNPKFAEAMSRSEQAAAGAEEWHDPREDGVLPDVYIAMGQTAENVA
LHTGISREEQDHWGVRSQNRAEEAIKSGFFEREIVPVTLPDGTVVSTDDGPRPGTTYEKI
SQLKPVFRPNGTVTAGNACPLNDGAAALVVMSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKKALANANMTIDDIDLYEINEAFAVQVLGSARALNMDLDKLNVSGGAIALGH
PFGMTGARITATLINNLQTHDKQFGLETMCVGGGQGMAMIIERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagccgtcattgtcgccaccgcgcggtcgccgatcggccgtgccgccaaggga
tcgctggtggatatgcggcccgacgacctcgccgcgcagatggtgcgcgcggtgctagac
aaggtgccggcgctcgatccccgcgagatcgacgacctgatcatgggctgcggccagccc
gcaggcgaggccggcttcaacatcggccgcgccgtggccgtgcagctcggctacgacttc
ctgccgggcaccaccgtcaaccggtactgctcgtcatcgctgcagaccacccggatggcg
ttccacgcgatcaaggccggcgagggtcacgcgttcatttccgctggggtggagacggtt
tcgcgtttcccgaagggcaccgcggacggctggccggacaccaagaacccgaagttcgcc
gaggcgatgagccgttcggagcaagccgcggcgggcgccgaggagtggcacgacccgcgt
gaggacggggtgctgcccgacgtctacatcgcgatgggccagaccgccgagaacgtcgcg
ctgcacaccggcatcagccgcgaggagcaggaccactggggtgtgcggtcgcagaaccgc
gccgaggaggccatcaagagcggcttcttcgagcgcgagatcgtgccggtgacgctgccc
gacggcaccgtagtgtccaccgacgacggcccgcgcccgggcaccacctacgagaagatc
agccagctcaagccggtgttccggccgaacggcacggtgaccgcgggcaacgcgtgcccg
ctcaacgacggcgccgccgcgctggtcgtgatgagcgacaccaaggccaaggagctgggc
ctgaccccgctggcgcgcatcgtgtcgacgggtgtgagcggtctgtcgccggagatcatg
ggcctgggcccgatcgaggcggtcaagaaggcgctggccaacgcgaacatgacgatcgac
gacatcgatctgtacgagatcaacgaggcgttcgcggtgcaggtgctgggttcggcgcgg
gcgctgaacatggatttggacaagctgaacgtctccggcggcgcgatcgcgctgggtcac
ccgttcggcatgaccggcgcccgcatcaccgccacgctgatcaacaacctgcagacccac
gacaagcagttcggtctggagaccatgtgcgtcggcggcggccagggcatggcgatgatc
atcgagcgcctctcctga

DBGET integrated database retrieval system