KEGG   Mycoplasma phocidae: DA803_00315Help
Entry
DA803_00315       CDS       T05577                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mpho  Mycoplasma phocidae
Pathway
mpho00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mpho00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DA803_00315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpho01007]
    DA803_00315
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpho03016]
    DA803_00315
   03029 Mitochondrial biogenesis [BR:mpho03029]
    DA803_00315
Enzymes [BR:mpho01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     DA803_00315
Amino acid related enzymes [BR:mpho01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   DA803_00315
Transfer RNA biogenesis [BR:mpho03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DA803_00315
 Prokaryotic Type
   Other AARSs
    DA803_00315
Mitochondrial biogenesis [BR:mpho03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DA803_00315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AXE60546
UniProt: A0A2Z5IQS5
Position
88137..89762
Genome map
AA seq 541 aa AA seqDB search
MNMTKDIIIASIEEALKKMNIKKPIILTESKSYGDYSTNIALTLQREIGKKAIDIANEIN
QNIDLKNYPEIKEIKVSEPGFINFWVSNSVFGDTVNQINKLGNDYGSIKDKNRGPINVEF
VSANPTGYLHIGHARNAAIGATLCNILEKGGYKVTREYLVNDYGNQMNRLAISVFSRYQQ
IFDKDYQMPEDAYRGGDIIQFAEEFHRQNQDKYKGVEYTEEMEALFKEFGRKFALKNIES
DLKRFGVWFDLYTSEAEQYKKNLVWPTIKRLKTTYVKDGATWLATTKGGKDDKDRVIIKS
NGDSTYLCADIAYHEQKFLQLNDKEKGIIIDVWGADHSGYVERVKFSFEDLGWRRDQLEI
ILFQLLRVVKNGKEIKMSKRLGTSLTLKELLDLVGKDAIRFFLIERSYNSKIDFDIAKVN
KPDETNPMYIIKYAHARCVQLLEKSANKNPIAKTLDNEYAQKLVNELKEYPDLIATMAKN
YKVNLLPPFLVKLAGAFNSFYSNTKVLGSENEESYLALVKATKIVLANGMQLMDLDIPDR
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgacaaaagatattattatagcttcaattgaagaagctctaaaaaaaatgaac
attaaaaagccaataattttgacagaatccaaaagttatggagactactcaacaaatatt
gctttaactttacagagggagattggcaaaaaagcaattgatattgcaaacgaaattaat
caaaatattgatttaaaaaattatccagaaattaaggaaatcaaggtttcagagcctggt
tttatcaatttctgagtatcaaattctgtctttggagacacagttaatcaaattaataaa
ttgggaaatgactacggtagtattaaagataaaaatcgtggtccaattaatgtcgaattt
gtatcagcaaacccaactggatatttacacatcggacatgctagaaatgccgcaattggt
gctacattatgtaacattttagaaaaaggtggttataaggttactcgtgaatatttagtt
aatgactacggaaatcaaatgaacagattggcaatttcggttttctcaagatatcaacaa
atttttgataaagattaccaaatgcctgaagatgcttaccgtggcggagatattattcaa
tttgcagaagaatttcataggcaaaatcaagacaaatataaaggtgttgaatacacagaa
gaaatggaggcattattcaaagaatttggtagaaaatttgccttgaaaaacattgaaagt
gatttaaaacgttttggcgtatgatttgatttatacacctctgaagctgaacagtataaa
aagaatttagtttgacctactattaagaggttaaaaactacttatgtaaaagatggagcc
acatgacttgcaaccactaaaggtggcaaggacgataaagaccgtgttattattaaaagt
aatggcgattcaacttatttatgtgctgatattgcctaccacgaacaaaagtttttacaa
ttaaatgataaagaaaaaggaattatcatcgacgtatgaggagcagatcactcaggttac
gttgaaagggttaaattttcatttgaggacttaggttgaagaagagaccaattagaaatt
attttattccaattactaagagttgtgaaaaatggtaaagagataaaaatgtctaaacgt
ttaggaacttcactaacattaaaagaattacttgatttagtaggtaaagatgcaattcgt
ttcttcttaattgaaagatcatataattcaaaaattgattttgatattgcaaaagttaac
aaaccagatgaaacaaacccaatgtatattattaaatatgcccatgctcgttgtgttcaa
ttactagaaaaatcggcaaataaaaatccaattgccaaaacattagataatgaatatgct
caaaaattagttaatgaattaaaagaataccctgacttaattgctactatggcaaaaaat
tacaaagttaatttacttccaccatttttagtaaaattagctggagcatttaactcattt
tattcaaatactaaagttctaggatcagaaaatgaagagtcatacttggcattagttaag
gcaactaaaattgttttagcaaatggtatgcaattaatggatctagatattccagataga
atgtaa

DBGET integrated database retrieval system