KEGG   Methylobacterium phyllosphaerae: MCBMB27_00960Help
Entry
MCBMB27_00960     CDS       T04968                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00450  Selenocompound metabolism
mphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MCBMB27_00960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mphy03016]
    MCBMB27_00960
Enzymes [BR:mphy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     MCBMB27_00960
Transfer RNA biogenesis [BR:mphy03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    MCBMB27_00960
 Prokaryotic Type
    MCBMB27_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: APT30251
Position
999234..1000283
Genome map
AA seq 349 aa AA seqDB search
MDTTPVRLTSLAHGGGCGCKLDPAVLRTLLADQPVAGPFERLLVGNETADDAAVWALDDG
TCLIATTDFFTPMVDDPHDFGRIAATNAISDVYAMGGKPMLALAILGMPVGKIAPETVAE
ILKGGAATCAEAGIPIAGGHSIDTPEPIYGLAVIGSCDRAHLRRNADARAGDVAILTKPL
GVGIYSAAIKREALDAAGHADFIATTTRLNKVGADLARDPEVHAITDITGFGLLGHGLEL
ARGAGLTFVIAEGGLPLLPRAEALAQEGFVTGASHRNWASFGGQVSLPEGLPDWRRHILT
DPQTSGGLLVTCTPARADAILAQCHAAGFAQAAVVGRFEAGPAAIRVEA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaccccggttcgtctcaccagcctcgcccatggcggcgggtgcggctgcaag
ctcgatcccgcggtgctgcgcacgctcctcgccgaccagccggtcgccggtcccttcgag
cgcctgctggttggcaacgagaccgccgacgacgcggcggtctgggccctggatgacggc
acctgtctgatcgccaccacggacttcttcaccccgatggtggacgacccacacgatttc
ggccggatcgccgccaccaacgccatctccgacgtctacgcgatgggcggcaagccgatg
ctggcgctggccatcctgggcatgccggtcggcaagatcgcccccgagaccgtcgccgag
atcctgaagggcggcgcagccacctgcgcggaggcgggcatccccatcgcgggcggccac
tcgatcgacacgccggagccgatctacggcctggcggtgatcggctcgtgcgaccgcgcg
catctgcggcgcaatgccgatgcccgggctggtgacgttgccatcctgaccaagcccctc
ggcgtcgggatctactcggcggcgatcaagcgggaggccctcgacgctgccggccacgcc
gatttcatcgccaccacgacacgcctcaataaggtcggggcggatctggcgcgcgatccg
gaggtccacgccatcaccgacatcaccggcttcggcctgctgggccacggcctcgaactc
gcgcgcggcgccggcctgaccttcgtgatcgccgagggcggcctcccgctcctgccccgg
gccgaggccctcgcgcaggagggtttcgtcaccggcgcctcgcatcggaactgggcgagc
ttcggaggccaggtgagcctgcccgagggcctgccggactggcgccggcacatcctcact
gatccccaaacctccgggggcctgctcgtcacctgcacccccgcgcgggcggacgcgatc
ctcgcccaatgccatgcggcgggcttcgcgcaggccgctgtcgtcggacggttcgaggcc
ggcccggctgcgatccgggtcgaggcctga

DBGET integrated database retrieval system