KEGG   Methylobacterium phyllosphaerae: MCBMB27_02901Help
Entry
MCBMB27_02901     CDS       T04968                                 

Definition
(GenBank) uronate dehydrogenase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00053  Ascorbate and aldarate metabolism
mphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    MCBMB27_02901
Enzymes [BR:mphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     MCBMB27_02901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 3Beta_HSD NAD_binding_10 adh_short
Motif
Other DBs
NCBI-ProteinID: APT32192
Position
3087247..3088077
Genome map
AA seq 276 aa AA seqDB search
MTTETVPQKPVLLTGASGALGRVLTRALGEQGWALRLTDRAPFPDPLPAGARFQLADLED
GPAILRLAEGCGTILHFGGISVEHPFETVIGPNIRGLYHVYDAARREGARMIFASSNHAI
GFHPRSAVLDDDCSLAPDGFYGLSKAYGELMGGLYRDKHGVESVFLRIGSCFPEPTDARM
LATWLSYADLTRLIARATLAPSLGPAGSVVIWAASNNSRMTWWRRDGRAVIGWTPQDSAD
SYAAALEGKTSGDPVVERYQGGGFAGIDYSRAAPPR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgagaccgtcccgcagaaacccgtcctcctgaccggagcctcgggcgcactc
gggcgcgtactgacccgcgccctcggcgaacaggggtgggccctccggcttaccgaccgc
gcccccttccccgaccccctgcccgcgggggcgcgcttccaacttgccgacctggaagac
gggccggcgatcctgcggctggccgagggctgtggcacgatcctccactttggggggatc
tcggtggagcatccgttcgagacggtgatcggccccaatatccgcggcctctaccacgtc
tatgatgcggcccgccgcgagggcgcgcggatgatcttcgcctcctcgaaccacgccatc
gggttccacccgcgctccgcggtactggacgacgattgcagcctcgccccggacggcttc
tacggcctgtccaaggcctacggcgagctgatgggcggcctctaccgcgacaagcacggg
gtggagagcgtcttcctgcggatcggctcgtgcttcccggagcccaccgacgccaggatg
ctggcgacctggctgtcctacgccgacctgacccggctgatcgcccgcgccaccctggcg
ccgagcctcggaccggccggttcggtggtgatctgggccgcatccaacaacagccgcatg
acatggtggcggcgggacgggcgcgccgtgatcggctggaccccgcaagacagcgcggat
tcctacgccgcggccctggaaggcaagaccagcggcgacccggtggtcgagcgctaccag
ggcggcgggttcgcggggatcgattattcacgggcggcgccaccgcggtga

DBGET integrated database retrieval system