KEGG   Methylobacterium phyllosphaerae: MCBMB27_03629Help
Entry
MCBMB27_03629     CDS       T04968                                 

Definition
(GenBank) transcriptional regulatory protein OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MCBMB27_03629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mphy02022]
    MCBMB27_03629
Two-component system [BR:mphy02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   MCBMB27_03629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Gamma_PGA_hydro Penicillinase_R
Motif
Other DBs
NCBI-ProteinID: APT32920
Position
complement(3858763..3859470)
Genome map
AA seq 235 aa AA seqDB search
MSNAARADLPDEAPHVLVVDDDRRLRELLARYLTDQGFRVTAAASAAEARARAQSVVFDA
MVLDVMMPGENGFDYARSVRETSRVPILMLTARSNPNDRVMGLEIGADDYLPKPFEPREL
TLRLNNIIKRSARPRAAAAEAVTFGPFAFRVDRGELRRDDELIRITEREREILTILAMAG
GANVEREQLAGPGGAAAERTVDVQINRLRRKTEVDPANPVFLQTVRGVGYRLAVD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatgccgcccgggccgacctgcccgacgaggcgccccacgtcctcgtggtcgac
gacgaccgccggctgcgcgaattgctcgcccgctacctcaccgaccagggcttccgggtc
accgcggcggcgagcgccgcggaggcgcgggcccgggcccagagcgtcgtgttcgacgcc
atggtcctcgacgtgatgatgcccggcgagaacggcttcgactacgcccgcagcgtgcgc
gagacgtcgcgtgtgccgatcctgatgctcaccgcccgctccaacccgaacgaccgggtg
atggggctggagatcggcgcggacgattacctgcccaagcccttcgagccgcgggagctg
acgctgcggctcaacaacatcatcaagcgcagcgcgcggccccgcgcggcggccgccgag
gcggtgaccttcgggccgttcgcgttccgggtcgaccggggcgagctgcgccgggacgac
gagctgatccgcatcaccgagcgcgagcgcgagatcctgacgatcctggcgatggcgggc
ggcgccaatgtcgagcgcgagcagctcgccggcccgggcggggccgcggcggagcgcacc
gtcgacgtgcagatcaaccgcctgcgccgcaagaccgaggtcgaccccgccaatccggtc
ttcctgcagaccgtgcggggcgtcggctaccggctcgcggtggattga

DBGET integrated database retrieval system