KEGG   Methylobacterium phyllosphaerae: MCBMB27_03632Help
Entry
MCBMB27_03632     CDS       T04968                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00670  One carbon pool by folate
mphy01100  Metabolic pathways
mphy01120  Microbial metabolism in diverse environments
mphy01200  Carbon metabolism
Module
mphy_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MCBMB27_03632
Enzymes [BR:mphy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     MCBMB27_03632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DNA_primase_lrg
Motif
Other DBs
NCBI-ProteinID: APT32923
Position
complement(3861602..3863275)
Genome map
AA seq 557 aa AA seqDB search
MPSDIEIARAATLKPIAQVAEKLGIPDDALHNYGKHIAKIDHGYIAGLESRKPGKLVLVT
AISPTPAGEGKTTTTVGLGDALNRIGEKTMICLREPSLGPCFGMKGGAAGGGKAQVVPME
QINLHFTGDFHAITSAHSLAAALIDNHVYWANELNIDVRRIHWRRVVDMNDRALRQITQS
LGGVANGFPREDGFDITVASEVMAVFCLAKDLADLEERLGRIVIAETRDRKLVTLKDVKA
TGAMTVLLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNSVIATRAGLRLADYTVTEAG
FGADLGAEKFLDIKCRQAGLTPSAVVVVATIRALKMHGGVDKKNLGAENIDALEKGFANL
ARHVTNLRGFGLPVVVGVNHFYADTDAEHAKLKELCRERLDVEAITCRHWAEGGAGAEEL
ARAVVKLSEAEPAPIRHAYETESRLSDKIRAIATKLYGAADIQIETKAQAKLATFEKDGY
GHLPICMAKTQYSFSTDPTLMGAPEGHIVGVRDVRLSAGAGFVVAICGEIMTMPGLPRVP
AADTIRLDANGQIDGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagatatcgagatcgcccgcgccgcgaccctgaagccgatcgcgcaggtcgcc
gagaagctcggcatcccggatgacgcgctccacaattacggcaagcacatcgccaagatc
gaccacggctacatcgccgggctggagagccggaagcccggcaagctcgtgctggtcacg
gcgatctccccgacgcccgcgggcgagggcaagaccaccaccacggtgggcctgggcgac
gccctgaaccgcatcggcgagaagaccatgatctgcctgcgcgagccgtcgctcgggccg
tgcttcggcatgaagggcggcgccgccggcggcggcaaggcccaggtcgtgccgatggag
cagatcaacctgcacttcaccggcgacttccacgccatcacgtcggcccacagcctcgcg
gccgcgctgatcgacaaccacgtctactgggcgaacgagctcaacatcgacgtgcgccgc
atccactggcgccgcgtcgtcgacatgaacgaccgggctttgcgccagatcacccagtcg
ctcggcggcgtcgccaacggcttcccccgggaggacgggttcgacatcacggtggcctcc
gaggtgatggcggtgttctgcctcgccaaggacctcgccgacctggaggagcgcctcggc
cggatcgtcatcgccgagacccgcgaccgcaagctcgtcaccctcaaggacgtgaaggcc
accggcgccatgacggtgctgctcaaggacgccctgcagcccaacctcgtgcagacgctc
gagggcaacccggcgctgatccatggcggccccttcgccaacatcgcccatggctgcaac
tcggtgatcgccacacgggccggcctgcggctcgccgactacacggtgacggaggccggg
ttcggcgccgatctcggcgccgagaagttcctcgacatcaagtgccggcaggcggggctg
accccctcggccgtggtggtggtggcgaccatccgcgccctcaagatgcatggcggcgtc
gacaagaagaacctcggggccgagaacatcgacgccctggagaagggcttcgccaacctc
gcccggcacgtgaccaacctgcgcggcttcggcctgccggtggtggtcggcgtcaaccac
ttctacgccgacaccgatgccgagcacgccaagctcaaggaactgtgccgcgagcggctc
gacgtcgaggcgatcacctgccgccactgggcggagggcggggccggggccgaggagctg
gcccgcgcggtggtgaagctctccgaggccgagccggcgccgatccgccacgcctacgag
acggagagccgtctctccgacaagatccgggcgatcgccaccaagctgtacggggccgcc
gacatccagatcgagacgaaggctcaggccaagctcgccaccttcgagaaggacggctac
ggccacctgccgatctgcatggccaagacccagtactcgttctccaccgacccgaccctg
atgggcgcccccgagggccacatcgtgggcgtgcgcgacgtccggctctcggccggcgcc
ggcttcgtggtggcgatctgcggggagatcatgaccatgccgggcctgccccgggtgccc
gccgccgacacgatccggctggacgccaacgggcagatcgacgggctgttctga

DBGET integrated database retrieval system