KEGG   Methylobacterium phyllosphaerae: MCBMB27_03728Help
Entry
MCBMB27_03728     CDS       T04968                                 

Definition
(GenBank) (S)-sulfolactate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00270  Cysteine and methionine metabolism
mphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MCBMB27_03728
Enzymes [BR:mphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     MCBMB27_03728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-ProteinID: APT33019
Position
3970059..3971000
Genome map
AA seq 313 aa AA seqDB search
MPKVVISEFMDPAAIAADLSGFDTLYDPGLVDRPEALAAAVAEADALIVRNRTQVRGALL
AGARRLRIVGRLGVGLDNIDVPACRARGITVRPATGANDGAVAEYVVATALLLLRGAYGA
SEAVAAGTWPRNALMGREIAGKRLGLVGFGSIARETARRAAALGMAIAAHDPFLAAEDPA
WTPPYGPVRRRDLEALIAESDVLSLHVPLTAETRGLIDATALARMPAGAVLINAARGGIV
DEAAVAAALRSGHLGGAALDVFDREPLDAAAGAPFAGVPNLILTPHIAGVTQESNVRVSA
VIAAAVRRHLTQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggtcgtcatcagcgaattcatggaccctgcggcgatcgccgccgacctgtcg
ggcttcgacaccctgtacgatcccggactcgtcgaccggcccgaggcactcgccgccgcc
gtggcggaggccgacgccctgatcgtgcgcaaccggacgcaggtccgcggcgcgctgctc
gcgggtgcccgacgcctccggatcgtcgggcgtctcggggtcggcctcgacaacatcgac
gttccggcctgccgggcgcgggggatcacggtccggccggcgacgggcgccaatgacggc
gcggtcgccgagtacgtcgtcgccaccgcgctgctgctgctgcgcggggcctatggggcg
agcgaggcggtcgcggcggggacgtggccgcgcaacgccctgatggggcgcgagatcgcc
ggcaaacgcctcgggctcgtgggcttcggatcgatcgcccgggagaccgcccgccgcgcc
gctgccctcggcatggcgatcgcggcccatgacccgttcctggccgccgaggatccggcc
tggacgcccccatacggtccggtgcggcgccgggatctggaggcgctgatcgcggagagc
gacgtgctctccctgcacgtcccgctcaccgcggagacccgcggcctgatcgacgcgacc
gccctcgcccggatgcccgcgggcgccgtgctgatcaacgccgcccggggcggcatcgtc
gacgaggccgcggtggcggccgccctgcggtccgggcatctcggcggcgcggccctcgac
gtgttcgaccgcgagcccctcgacgccgcggccggcgccccgttcgcgggcgtgccgaac
ctgatcctcacgccccacatcgccggggtgacgcaggaatcgaacgtccgggtctcggcc
gtcatcgccgcggcggtgcgccggcatctcacgcagggctga

DBGET integrated database retrieval system