KEGG   Methylobacterium phyllosphaerae: MCBMB27_04986Help
Entry
MCBMB27_04986     CDS       T04968                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00071  Fatty acid degradation
mphy00072  Synthesis and degradation of ketone bodies
mphy00280  Valine, leucine and isoleucine degradation
mphy00310  Lysine degradation
mphy00362  Benzoate degradation
mphy00380  Tryptophan metabolism
mphy00620  Pyruvate metabolism
mphy00630  Glyoxylate and dicarboxylate metabolism
mphy00640  Propanoate metabolism
mphy00650  Butanoate metabolism
mphy00900  Terpenoid backbone biosynthesis
mphy01100  Metabolic pathways
mphy01110  Biosynthesis of secondary metabolites
mphy01120  Microbial metabolism in diverse environments
mphy01130  Biosynthesis of antibiotics
mphy01200  Carbon metabolism
mphy01212  Fatty acid metabolism
mphy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCBMB27_04986
   00630 Glyoxylate and dicarboxylate metabolism
    MCBMB27_04986
   00640 Propanoate metabolism
    MCBMB27_04986
   00650 Butanoate metabolism
    MCBMB27_04986
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCBMB27_04986
   00072 Synthesis and degradation of ketone bodies
    MCBMB27_04986
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCBMB27_04986
   00310 Lysine degradation
    MCBMB27_04986
   00380 Tryptophan metabolism
    MCBMB27_04986
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCBMB27_04986
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCBMB27_04986
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MCBMB27_04986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mphy04147]
    MCBMB27_04986
Enzymes [BR:mphy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCBMB27_04986
Exosome [BR:mphy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCBMB27_04986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5423 DUF2575
Motif
Other DBs
NCBI-ProteinID: APT34277
Position
5332569..5333777
Genome map
AA seq 402 aa AA seqDB search
MTDAFIYDHVRTPRGRGKADGALHEVTALRLAETALRALKVRNGLDTALVDDVILGCVDP
VGEAGGDIARAAALVADYGAHVPGVQINRFCASGLDAVNFAAAQVMSGQHEMAVGGGVES
MSRIGIGASGGAWPVDPAIAIKSYFMPQGISADLIATKYGFTRDACDAYAVRSQARAAKS
WEDGLFDRSVVPVRDVNGITLLDRDEHMRPGTDMQSLAALKASFVQMGQMGGFDAVATDA
HPDVESVDHVHHAGNSSGIVDGAAAVLIGSRAAGEAAGLRPRGRIRAFANIGSDPALMLT
GPVDVTRKILAKTGLSLSDIDLFEVNEAFAAVVLRFCQAFDLDPEAVNVNGGAIALGHPL
GATGAMILGTALDELERTGKERALITLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcatctacgaccacgttcgcacgccgcgcggtcgcggcaaggcggac
ggcgccctccacgaagtgaccgcgctccggctggccgagacggcgctgcgcgccctcaag
gtccgcaacgggctcgacacggccctcgtcgacgacgtgatcctgggctgcgtcgatccg
gtcggggaggcgggcggcgacatcgcccgggccgcggccctggtggccgattacggcgcg
catgttccgggtgtgcagatcaaccgtttctgcgcctcgggcctcgacgcggtgaacttc
gccgccgcacaggtcatgagcggtcagcacgagatggcggtgggcggcggcgtggaatcg
atgagccgcatcggcatcggcgcctcgggtggcgcctggccggtggatccggcgatcgcc
atcaagtcctatttcatgccgcagggaatctcggccgacctgatcgccaccaagtacggc
ttcacccgcgacgcgtgcgacgcctacgcggtccgctcgcaggcgcgcgcggcgaagtcc
tgggaagacggcctgttcgaccggtccgtcgttccggtccgcgatgtgaacggcatcacc
ctgctcgaccgcgacgaacatatgcgcccgggcaccgacatgcagtcgctggccgccctg
aaggcgtcgttcgtgcagatgggccagatgggcggcttcgacgccgtggcgacggacgcg
catccggacgtggagagcgtggatcacgtccatcatgccggcaattcctccggcatcgtc
gacggtgcggccgccgtgctgatcggctcccgggcggccggcgaggccgcgggcctgcgc
ccgcgcggccggatccgggccttcgccaatatcggctcggacccggccctgatgctcacc
gggccggtggacgtcacccgcaagatcctggcgaagactggcctgagcctgtcggatatc
gacctgttcgaggtcaacgaggctttcgcggcggtggtcctgcgcttctgccaagccttc
gacctcgatccggaggccgtcaacgtgaacggcggcgccatcgccctcggccaccctctg
ggcgccaccggagcgatgatcctcggcacggccctcgacgagctggagcggaccggcaag
gagcgggcgctgatcaccctgtgcatcggcgccggcatgggaaccgccaccatcatcgag
cgggtgtga

DBGET integrated database retrieval system