KEGG   Methanolacinia petrolearia: Mpet_0915Help
Entry
Mpet_0915         CDS       T01312                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00260  Glycine, serine and threonine metabolism
mpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01130  Biosynthesis of antibiotics
mpi01230  Biosynthesis of amino acids
Module
mpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpet_0915
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpet_0915
Enzymes [BR:mpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpet_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE PcrB TMP-TENI ThiG FMN_dh BtpA NMO Ribul_P_3_epim PA IMPDH IGPS DHO_dh ADH_zinc_N Dus
Motif
Other DBs
NCBI-ProteinID: ADN35682
UniProt: E1RJN5
Position
complement(928975..929760)
Genome map
AA seq 261 aa AA seqDB search
MDRIKKAFSKPAFVAYMVAGDPDTERSKIVASALVDGGADIIEVGIPFTDPVADGPVIQA
ADGRALSSGAVPATAFEIAGHIRSISEAAIVIFTYINPIIRMGFDRFYAEAKANGANAVL
IVDMPVEESDEALAAAEKHGLAQIFLVSITTSEERMKKIAGKAKGFAYLISALGTTGQRD
KIPDEALDLIARAKKTFDIPVVVGFGISGPENAKKMIDAGADGVVVGSAIVSAVGENLES
DDGIYESVKGLVGRIRSGIVH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaataaaaaaggctttctcgaaacctgcgttcgtcgcctacatggtggcgggc
gacccggatacggagagatcgaagatcgtcgcctcggcccttgtcgatggcggtgcggat
atcatcgaggtcggaatcccgttcactgatcctgtggcagacggcccggtgatccaggcg
gcggacgggagggcactctcctcgggagcggttccggcgactgcctttgaaatcgcgggc
catatcaggagcatctcggaggccgcgatcgtgatcttcacgtacataaacccgataatc
agaatgggtttcgacaggttctacgccgaagcgaaggcgaacggtgcgaatgcggtgctc
atcgtcgatatgccggtcgaagagtcggacgaggctcttgcagcggcggagaagcacggg
cttgcacagatctttctggtctcgattacgacgagcgaagagaggatgaagaagatcgca
gggaaggcgaagggctttgcatatctcatctccgctctcggaacgaccggacagagagac
aagatcccggatgaggccctcgatcttatcgcgagggcgaagaagacgttcgacatcccg
gtcgtcgtcggcttcgggatctcggggcccgagaacgcgaagaagatgatcgacgcgggt
gcagacggtgtcgtcgtcgggagtgcgatcgtttcggctgtcggggagaatcttgagagt
gacgatgggatttatgaatcggtgaaagggcttgtgggcaggatcaggtctggcatagtt
cattaa

DBGET integrated database retrieval system