KEGG   Methanolacinia petrolearia: Mpet_1079Help
Entry
Mpet_1079         CDS       T01312                                 

Definition
(GenBank) DNA binding domain protein, excisionase family
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00620  Pyruvate metabolism
mpi00640  Propanoate metabolism
mpi00680  Methane metabolism
mpi00720  Carbon fixation pathways in prokaryotes
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
mpi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_1079
   00620 Pyruvate metabolism
    Mpet_1079
   00640 Propanoate metabolism
    Mpet_1079
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_1079
   00680 Methane metabolism
    Mpet_1079
Enzymes [BR:mpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpet_1079
Lipid biosynthesis proteins [BR:mpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpet_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C HTH_17 MerR_1 HTH_23 Terminase_5
Motif
Other DBs
NCBI-ProteinID: ADN35846
UniProt: E1RKJ3
Position
1095454..1097322
Genome map
AA seq 622 aa AA seqDB search
MSTSKAPFYTPQEVADRLRVETRTVHAWLRDGTMKGMKVGRLWRIPESEIDRVRNNIGPA
NGDLGFDIRYKPQNMTDYDYAYKNFRIEVPEKFNFGYDVIDQWADRERNKLAMIWVNTQG
SEKKYSFRDLKNLSNQAANILLKYDINKGDRILIMLPRIPEWWIFVIGIIKLGAVVCPCP
VLLTPKDLKYRINVGKFKMVITDLENAPKINEICKECPSLRSRFVVDGELEGWASYPLEL
LYPAPVSHKSVSMPESFTTYADDPMLIYFTSGTTGEPKMVLHNNAYPLGHRVTAELWHDL
TPNDVHFTYSDTGWAKCAWGKIFGQWIAGACQLIIDVRGHFEATKLLPFIEKYEVTSFCA
PPTVYRMLILADLSKFDLRELRHCTSAGEPLNPEVIKVWKEGTGCTIYEGYGQTETCCAI
SSFPCIRNKPGSMGKPSPGWHIELHDDDGKPVGIHEEGRIAISLNPRPVGLVVEYIDNPE
ANAESFRNGFYYTGDKAYRDEDGYFWFVGRNDDVIKSSGYRIGPFEVESALLEHPAVQES
AVVGSPDRIRGLIVKAFVVLNKGYTPSEDLVRDIQKYVKTVTAPYKYPRAIEFVDELPKT
LSGKIKRNELRDRELKAFRKRE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgtcaaaggctcctttctacaccccgcaggaggttgcagacaggctcagagtt
gagacgagaacggttcatgcatggctgcgtgacggtacaatgaaaggtatgaaagttggc
cggctttggagaatcccggagagcgagatcgatcgtgtcaggaataacatcggtcctgca
aacggagatctgggttttgatatacgctacaaaccgcagaatatgaccgactacgactat
gcctataaaaatttcaggatcgaagtccccgagaaattcaatttcgggtatgatgtcatc
gaccagtgggccgacagggagagaaacaaactcgcgatgatctgggtgaacacccagggc
agcgagaagaagtactctttccgcgacctgaagaatctctcgaaccaggcggcgaatatt
cttctgaaatacgatatcaacaaaggggatcgcatccttataatgctgccacgtatcccc
gagtggtggatcttcgtcataggtattatcaaactcggtgcggttgtctgcccgtgtcct
gtccttcttacaccaaaggatctcaagtacaggataaatgtaggaaagttcaagatggtc
atcaccgatctcgagaatgctccgaagatcaatgagatctgcaaggagtgtccgtctctc
cgttcgagattcgtagtcgacggcgaactcgagggctgggcgagttatcctctcgaactg
ctttatcctgcaccggtttcacataaatctgtcagcatgcccgagagctttactacatat
gccgacgacccgatgctgatctattttacatccgggactaccggcgaaccaaagatggtt
cttcataataatgcatatcctctcggtcacagggtgaccgccgaactatggcatgacctg
acaccaaatgacgtccactttacgtactccgacaccggctgggcgaaatgtgcctggggc
aagatattcgggcagtggattgcgggcgcctgccagctcatcatcgatgtgagggggcat
ttcgaggccacgaaactgcttcctttcatcgaaaagtacgaggtgacgagcttctgcgca
ccgccgacagtgtacagaatgctcattcttgcagacctgagcaagttcgatcttcgcgaa
ctccgtcactgcaccagtgccggcgaaccgctgaacccggaggtcatcaaggtttggaag
gagggaacgggctgcacaatctatgaaggatacgggcagactgaaacatgctgtgcaatt
tcatctttcccctgcatcaggaacaaaccaggttctatgggcaagccttcgccgggatgg
cacatcgagcttcatgatgacgacgggaaacctgtcggaattcacgaggagggaaggatt
gccatctctctcaacccgaggccggtggggcttgtcgtcgagtacatcgacaaccccgag
gcgaacgcagaatctttccggaacggattttattataccggcgacaaggcgtacagggac
gaggacggttacttctggtttgtcggccgcaacgacgatgtcataaagagttcggggtac
aggattggtccgttcgaggtcgaatcggcgcttctcgaacacccggcagtccaggaatcg
gccgtcgtaggatctcccgacaggatacgcggtcttatcgtcaaggcgtttgtcgtactc
aacaaaggatacacaccgtcggaagatctcgtgagggacatccagaaatacgtcaagaca
gtgacggcaccgtacaagtacccaagagcgatcgaatttgttgatgaactgcccaagact
ctttccggaaagatcaaaaggaacgaactgagggacagggagctcaaggcattcaggaaa
agggaatag

DBGET integrated database retrieval system