KEGG   Methanolacinia petrolearia: Mpet_2088Help
Entry
Mpet_2088         CDS       T01312                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00051  Fructose and mannose metabolism
mpi00562  Inositol phosphate metabolism
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
mpi01200  Carbon metabolism
mpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2088
   00051 Fructose and mannose metabolism
    Mpet_2088
   00562 Inositol phosphate metabolism
    Mpet_2088
Enzymes [BR:mpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpet_2088
Exosome [BR:mpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpet_2088
  Exosomal proteins of bladder cancer cells
   Mpet_2088
  Exosomal proteins of melanoma cells
   Mpet_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS His_biosynth Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ADN36836
UniProt: E1RJV2
Position
2095218..2095892
Genome map
AA seq 224 aa AA seqDB search
MPEEKPVIMINFKTYNESYGFRAHDIAEAAETVAEESGIEIVICPGFMDIHPMSNHYRLP
VFAQHIDGISPGAHTGHILAEAVRAAGATGTLINHSERRLTLADISAAVDAAKRANLKTV
VCTNNTATSGAAAALSPDYVAIEPPELIGSGISVATADPEIIENSVNAVKSVNKDVKVLA
GAGISSGSCVKRAVELGSDGVLLASGVVKAEDPAVVLRDLVSKI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaaaagcccgttataatgataaacttcaagacctacaacgagagttacggt
ttcagggctcatgacattgccgaggcagccgagaccgtagcggaagaaagcggcattgaa
atcgtaatctgtcccggattcatggatatacacccgatgtcaaaccattaccgcctgcct
gtcttcgcccagcatatagacggaatctcgcctggcgcacacacggggcatatccttgcc
gaggcagtaagagcggcgggagctacgggcacgcttatcaaccactcggagagaagactg
actcttgcggatatctccgcggctgtggacgcagcaaaaagagcaaatctgaagaccgta
gtctgtacaaacaacacagcgacgagcggagcggcggcggcactctctcccgactacgtg
gctatcgaaccgccggaactcatcggcagcgggatttcggttgcaacggcagacccggaa
ataatcgaaaattcggtaaatgcggtaaaatcagtcaacaaagatgtcaaagtccttgca
ggtgcgggaatcagttcgggctcgtgtgtcaaaagagctgtcgaactcggctcggacggg
gtactgctcgcatcgggggtcgttaaggccgaagaccccgcagtggtcctgagagacctt
gtctcaaagatctaa

DBGET integrated database retrieval system