KEGG   Microcystis panniformis: VL20_544Help
Entry
VL20_544          CDS       T04037                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mpk  Microcystis panniformis
Pathway
mpk00430  Taurine and hypotaurine metabolism
mpk00620  Pyruvate metabolism
mpk00640  Propanoate metabolism
mpk00680  Methane metabolism
mpk01100  Metabolic pathways
mpk01120  Microbial metabolism in diverse environments
mpk01200  Carbon metabolism
Module
mpk_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VL20_544
   00640 Propanoate metabolism
    VL20_544
  09102 Energy metabolism
   00680 Methane metabolism
    VL20_544
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    VL20_544
Enzymes [BR:mpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     VL20_544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKV65763
UniProt: A0A0K1RVH2
Position
445859..447064
Genome map
AA seq 401 aa AA seqDB search
MKILVLNAGSSSQKSCLYDLDFFPSHPPQPIWAAGIDWTVNPDYGVLTVKAKGIKQEINL
SSQDRPAAIARMLETLVTGETKVVANLADISIVGHRVVHGGTEYSQATMITPPVKETIKK
LIPLAPSHNPAHLEGIEAIEQVLGDVPQIAVFDTAFHRSIPPESSLYPIPYQWSELGIRR
YGFHGTSHQYCSQRAAELLGKPLESLKMVICHLGNGASLSAVKGGKSVDTTMGFTPLEGL
MMGTRSGSIDPGILIYLEREYQYNPDSLNSLLNKESGLKGISGISGDMRAITTAIDEGNE
RAKLAFEMYIHRLKSLIGSMIASLEGLDVLVFTAGIGENSALVREKASQGWSFLGLELDL
AKNAARPRDEDIATDTSKVKVMVIATAEDWAIARECWHFFQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctggtcttaaatgcgggatcgagcagtcaaaaaagttgtttatacgattta
gattttttcccctcccatcctccccaaccaatttgggcagcgggaatcgattggacggtt
aaccctgattacggggttttaacggtaaaagccaagggaattaaacaggaaattaatctt
tctagtcaggatcgtccggcggcaattgctcggatgttagagactttagtcactggcgaa
actaaggtggtggccaacctcgcagacattagtatagtcggtcatcgagttgtccatggt
ggcacggaatattcccaagcaactatgatcactcccccagtcaaagaaacgattaaaaag
ctgatcccccttgctcctagccataatcccgctcatttagaaggaattgaagcgatcgag
caagttttaggcgatgttcctcaaatagcagtgtttgacaccgcttttcatcgttctatc
cctcccgagtcttctctttatcccattccctaccaatggagtgaactgggaatccgtcgc
tatggttttcatggcaccagtcatcagtactgctcccaacgggccgccgaattgttggga
aaacccctagaatccttgaaaatggtcatctgtcatctgggtaatggtgcttccctatcg
gcagtcaaggggggtaaaagtgtcgatactactatgggatttactcccctagagggattg
atgatgggaacccgcagcggttcgatcgatccagggattctgatttatctagagcgagaa
tatcaatataatcccgatagtttaaatagtttactcaataaagaatcgggtttaaaggga
atttcgggtatttctggggatatgcgggcaattaccacggcgatagacgaaggcaacgag
agggcaaaattagcatttgagatgtatattcatcgtctgaaaagtttaatcggatcgatg
atcgcttctctagaggggttagatgtcttggtatttacggcaggaatcggcgaaaattca
gctttagtgcgggaaaaagccagtcaaggctggtcttttttgggtttagagttagatttg
gctaaaaatgccgctcgtccccgggatgaggatatcgccaccgacacatctaaagtaaaa
gtgatggtaattgccacggcggaagattgggcgatcgcaagagaatgctggcatttcttt
caatag

DBGET integrated database retrieval system