KEGG   Candidatus Methanosphaerula palustris: Mpal_0214Help
Entry
Mpal_0214         CDS       T00823                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00260  Glycine, serine and threonine metabolism
mpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01130  Biosynthesis of antibiotics
mpl01230  Biosynthesis of amino acids
Module
mpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpal_0214
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpal_0214
Enzymes [BR:mpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpal_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Pterin_bind ThiG
Motif
Other DBs
NCBI-ProteinID: ACL15600
UniProt: B8GJ27
Position
complement(246780..247607)
Genome map
AA seq 275 aa AA seqDB search
MNRIDQVFTGRNRPAFIAFTVAGDPDPETSVKVAEALATAGADIVELGMPFSDPSADGPV
IQRADQRALEAGTTPDTLFSIIRGIRERSAVPIMILTYYNPVFRRGIDRFYREAADVGAD
GILIVDLPAEEIGVARTAADRYGLCQIVMATPTTTDRRLELVGSAGSGFLYVVSVAGVTG
ARDHLATGVGDLLERIRSRTTLPLAVGFGISRPEHMQAIAAAGGDAAIVGSAIASIIEEH
THDTDRMIEALRVYVTRMRRSLEPKFKDRSKEHIP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatagatcaggtctttactggacgaaatcggccggcgttcatcgccttcacc
gtagccggcgacccggatccagagaccagcgtcaaggtcgccgaggcgctggccaccgcc
ggggccgacatcgtcgaactcgggatgcccttctccgatccgagcgccgacggcccggtg
atccagcgagccgaccagcgagctctcgaagcagggaccacaccggatacgctcttctcg
atcatcagggggatacgggaacggtcggcggtaccgatcatgatcctgacttactacaac
ccggtattccggcgtggtatcgaccgattctaccgggaagccgccgatgttggggccgac
gggattctgatcgtggatctccctgcagaagagatcggcgtggcccggacggcggccgat
cggtacggtctctgtcagatcgtgatggccaccccgaccaccaccgaccgacgactcgag
ctggtcgggtctgcagggagcgggttcctgtatgtggtctcggtggcaggtgttaccgga
gcccgggatcacctcgccacaggagtcggagatctgctcgaacggatacggagcaggacc
acccttccgctagccgtcgggtttgggatctcgcgccctgagcacatgcaggcgatcgct
gcagccgggggcgacgcggcgatcgtcggatctgccatcgcatcgatcatcgaggagcat
actcatgatacagatcgaatgatcgaggcactcagagtctatgtaaccaggatgcggaga
tccctggaacccaaattcaaagacagatcaaaagaacacattccataa

DBGET integrated database retrieval system