KEGG   Candidatus Methanosphaerula palustris: Mpal_0216Help
Entry
Mpal_0216         CDS       T00823                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01130  Biosynthesis of antibiotics
mpl01230  Biosynthesis of amino acids
Module
mpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpal_0216
Enzymes [BR:mpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mpal_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACL15602
UniProt: B8GJ29
Position
complement(248791..249594)
Genome map
AA seq 267 aa AA seqDB search
MILDHLAAASRVRGAHLPTGGYPPSAHRPVSLAGAIRNASNRHAVIAEIKPASPSMGAIR
MIPDPGELGAALAGGGCVGLSVLTEPELFGGSVEALQQVRARTTIPILRKDFITDLRQIA
ETQAISADAVLLIARLLGDDLPTFVRAALDAGLEPLVEVHTEEEMDSALATSTPLIGINN
RDLATLQIDRSVTRRLAHLAAGAGRVVISESGIKTPGNLMELTPFADAFLIGTAVMAAPD
PVTALKGFIHAGYQGENDENEKRETRD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgatcacctggcagcggcctcccgggtgaggggcgcccacctcccaaccggg
ggatatccaccctccgcccatcggccggtcagcctggccggggcgatcagaaacgcctcc
aatcggcacgccgtgatcgcggaaatcaaacctgcatccccgtccatgggagcgatcagg
atgatcccggacccaggagaacttggggcagcgctggccggaggcggctgcgtcggcctc
tcggtgctgaccgaaccggaactgttcggggggtcggtggaggccctacagcaggtgcgg
gccagaaccaccatcccgatcctccgaaaggacttcatcaccgacctccggcagatcgcc
gagacacaggcgatcagcgccgacgccgtgctgttgatcgcacgcctcctcggggatgac
ctccccaccttcgtcagggcagccctggatgccgggctggagccgctggtcgaggtgcac
acagaagaggaaatggactcagcactcgcgaccagcaccccgctgatcgggatcaacaat
cgggatctggccacccttcagatcgaccgatctgtcaccagaaggctggcgcacctggct
gccggagccggccgggtggtgatcagcgagagcgggatcaaaacccccgggaacctgatg
gaactgactccgttcgccgacgcatttctgatcgggacggcggtgatggccgcgccggac
ccggtgacggccctgaaagggttcatccatgcaggctatcagggggaaaatgatgagaat
gagaagagggagaccagagattga

DBGET integrated database retrieval system