KEGG   Methanosphaerula palustris: Mpal_0468
Entry
Mpal_0468         CDS       T00823                                 

Definition
(GenBank) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
mpl  Methanosphaerula palustris
Pathway
mpl00240  Pyrimidine metabolism
mpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mpal_0468
Enzymes [BR:mpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     Mpal_0468
SSDB
Motif
Pfam: Cytidylate_kin2 Cytidylate_kin AAA_17 AAA_18 AAA_28 ADK AAA AAA_33 RuvB_N
Other DBs
NCBI-ProteinID: ACL15842
UniProt: B8GKF9
Position
473154..473684
AA seq 176 aa
MRITISGPPGSGTTSLSKHLAAEHNLKLISAGEVFRQLAREKGMDLAAFGELAENDPSID
LMIDARQKQIATEQDDIIVEGRLSGRMVEQADLRIWLNAPLTCRVGRIAFRDSVTCEEEA
MTLTREREASEAKRYMMYYQIDISDLSSYHLVLNTERWSVGQLGLIVNCAIAAVRD
NT seq 531 nt   +upstreamnt  +downstreamnt
atgcggatcaccatcagtggtcctcctggcagcggaaccacatctctctccaagcatctg
gcagcggaacataacctgaaactcatctctgcaggggaagtctttcggcagctcgccagg
gagaaggggatggacctcgctgcgtttggggaactggcagagaatgatccatcgatagat
ctgatgatcgatgcccgtcagaaacagatcgcaacagaacaggatgatatcatcgttgaa
gggcgcctctcggggcggatggtagagcaggccgatctccggatctggctgaacgctcca
ctgacctgcagggtaggtcggatcgcttttcgggacagtgtgacctgtgaagaggaggcg
atgacgctgacccgagagcgggaggcctctgaggccaaacgctatatgatgtattatcag
atcgatatcagcgatctctcctcctatcacctggtgctgaacaccgagcggtggtcggtc
ggccagctcggcctgatcgttaactgtgccattgccgcggtcagagattga

DBGET integrated database retrieval system