KEGG   Methanosphaerula palustris: Mpal_0526Help
Entry
Mpal_0526         CDS       T00823                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mpl  Methanosphaerula palustris
Pathway
mpl00230  Purine metabolism
mpl00240  Pyrimidine metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01130  Biosynthesis of antibiotics
Module
mpl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mpl_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mpal_0526
   00240 Pyrimidine metabolism
    Mpal_0526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpl04131]
    Mpal_0526
Enzymes [BR:mpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Mpal_0526
Membrane trafficking [BR:mpl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Mpal_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACL15899
UniProt: B8GKL6
Position
529205..529654
Genome map
AA seq 149 aa AA seqDB search
MDRTFVMIKPDGVQRGLIGQIVARLEDKGLKMVAARFERLAEATVNEHYREHIERSFYPS
LKQYIMSGPCFLMVWEGKNAAAVVRTLTGATNPSEAAPGTIRGDYGLDIGRNVIHASDAP
ESAAREIALHFPGTGQVTYTRIDEPVLYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggaccggacctttgtgatgatcaagcccgatggagtccagcgcggcttaatcgggcag
atcgtcgcccggcttgaggacaaggggctgaagatggtggccgcacgatttgagcggctc
gctgaggcgacggtgaatgaacactaccgtgagcacatcgaacggtcgttctatccctcg
ctcaagcagtatatcatgagcggtccctgtttcctgatggtctgggagggaaagaatgcg
gctgcggtggtcagaacgctgaccggcgcaaccaacccatccgaggccgctcctggcact
atcaggggcgattacggtcttgacatcggtaggaatgtgatccatgcgtccgacgctcct
gagagcgccgcacgcgagattgcacttcacttcccgggcaccggacaggtcacctataca
cggatcgatgaaccggtcctgtatgagtga

DBGET integrated database retrieval system