KEGG   Methanosphaerula palustris: Mpal_1010Help
Entry
Mpal_1010         CDS       T00823                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
mpl  Methanosphaerula palustris
Pathway
mpl00020  Citrate cycle (TCA cycle)
mpl00620  Pyruvate metabolism
mpl00720  Carbon fixation pathways in prokaryotes
mpl01100  Metabolic pathways
mpl01120  Microbial metabolism in diverse environments
mpl01200  Carbon metabolism
mpl01230  Biosynthesis of amino acids
Module
mpl_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpal_1010
   00620 Pyruvate metabolism
    Mpal_1010
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_1010
Enzymes [BR:mpl01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mpal_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACL16358
UniProt: B8GGV3
Position
complement(1040486..1042225)
Genome map
AA seq 579 aa AA seqDB search
MSAADPVNRLYITDTTLRDAHQSLIATRLRTEDMLPLARLIDGAGFFSAEAWGGATFDTC
IRFLNENPWERLRELKAALPKTPIQMLLRGQNLVGYRHYSDDVVDRFVERSAVNGVDIFR
VFDALNDIRNMKRSMDQVKNVGGHLQGAISYTLSPVHNTETFIAMAEELYAAGCDSICIK
DMAGLIMPEATRELITGIKKTVDIKVCLHSHSTSGIAPMSYQAAIEAGVDILDTAMSPFS
LGTSQPPTESVVASTQGTKRETGIDLLTLRKIRNNCLKIREKYNALVNPISERVDSDVLI
YQLPGGMISNLVSQLQEQDALDRLDDVFAEVPKVRRDLGYPPLVTPTSQIVGSQAVLNVL
LGGERYQNVTKEVKDYVRGLYGRSPAPISDEIRRLIIGEEKVITGRPADLLEPTYDKMFE
QAKLAGLASTEEDVLTYIMYPAIAPSFLKGERKAEAIPSSEPVAKASSTVPSQMEVEVDG
EIFNIRIISVEGSQVGKKGPVEKIPRGEIVGGVKSNMQGMVLEVMTSRGAVVKKGDTLLV
LEAMKMENPIHSTRDGVVTEIFVDAGDVVQNGDVLLVME
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcagatcctgtaaacagactttatatcaccgataccacgctgagggatgcc
catcagtcactcatcgcgacgcgcctccggactgaggatatgttacctctcgcccgcctg
atcgacggggccggcttcttctcagccgaggcatggggaggtgcgacctttgacacctgt
atccgatttttaaatgagaatccctgggaacgtcttcgggaactaaaagccgcgctgcca
aagactccgattcagatgctactgcgggggcagaatctggtcgggtaccggcactactct
gacgatgtcgtggaccggtttgttgagcgttcggccgtaaacggtgtcgatatcttccgg
gtcttcgatgcattgaacgatatccggaatatgaagcggtcaatggatcaggttaagaac
gtcggtggtcatctgcagggtgcgatctcgtatacgctctccccggttcataacactgag
accttcatcgcgatggcagaggaactgtatgcagcgggttgtgactcgatctgcatcaag
gatatggccggactgatcatgccggaggcaacacgggaactgatcaccgggatcaagaag
acggtcgacatcaaggtctgtcttcattcccattccaccagcgggattgcaccgatgagt
tatcaggcggcgatcgaagccggggtcgacatccttgataccgcgatgtccccgttctcg
ctcggcacctcacagcccccgaccgagagtgtggtcgcttcgacgcagggaacaaagagg
gagaccggaatcgacctgctgacattgcggaagatccggaacaactgcttgaaaatccga
gagaagtacaatgccctggtcaacccgatctcagaacgggtcgactcggatgtactgatc
tatcaactccctggcgggatgatctcaaatctggtctcgcagttgcaggagcaggacgct
ctcgaccggctcgatgatgtctttgccgaggtgccaaaggtccggcgcgaccttggatat
ccacccctggtgaccccgaccagccagattgtgggttcacaggctgtcctgaacgtgttg
ctcggtggcgaacgctaccagaacgtgaccaaggaggtgaaggattatgtgcgaggttta
tatggccgttcacctgcccctatcagcgacgagatcagaagattgatcatcggggaggag
aaggtgatcacgggccggccagccgacctgctcgaaccgacctatgataaaatgtttgaa
caggcgaaactggccgggcttgcctccaccgaggaggatgtgctcacgtacatcatgtac
ccggcgatcgccccatcgtttttgaagggcgaacggaaggcggaggcgatcccttcctca
gagccagtggccaaagcaagcagcacagtcccgtcccagatggaggtggaggtggacggc
gagatcttcaatattcggattatctcagtcgagggatcccaggtcggaaagaaaggacca
gttgagaagatcccgcggggcgagatcgtcggcggggtcaagtccaatatgcaggggatg
gttcttgaggtgatgacgagcaggggggctgtcgtcaagaagggggacacgctgctggtg
cttgaagcaatgaagatggagaacccgatccacagcacacgggatggggtagtcaccgag
atcttcgtcgatgcaggtgacgtcgtccagaacggcgatgtgctgctggtgatggaatga

DBGET integrated database retrieval system