KEGG   Candidatus Methanosphaerula palustris: Mpal_1295Help
Entry
Mpal_1295         CDS       T00823                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00250  Alanine, aspartate and glutamate metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpal_1295
Enzymes [BR:mpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mpal_1295
Peptidases [BR:mpl01002]
 Cysteine Peptidases
  Family C44
   Mpal_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase NAD_synthase QueC Pdase_C33_assoc
Motif
Other DBs
NCBI-ProteinID: ACL16629
UniProt: B8GHM4
Position
1326661..1327665
Genome map
AA seq 334 aa AA seqDB search
MTAIDVKGWVEKDGNRLSINEIEELIRTGPEQFSECGGEFLVRWDDCAARDHWGIMPGEI
DAGTVTCKGNIMCRVDPPADASSLEEAIVTAVRLRSDEGVTALSGGVDSTLVAAIAERPC
VAVGVEDSHDLVRARHAAEALHLSCDYVTIKPDAVEEALAAVIPVIPARDPVNISIAATM
YFVASYARENGYTRILAGQGADELFGGYSRYLVSTDLAATFAEDFKGLALQGARDQAVAG
LFGAYLSMPYLDVRVVRAAEAISPSDRVSGGIRKKPLREVAARYIPAEIADYDKKAMQYG
TGVWKVIQHLARHNGYNKSVQGYLNHVGRLHDGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaatcgatgtgaagggctgggttgaaaaggatggtaaccgcctctcgatcaat
gagatagaggaactgatccgcactggcccggaacagttctcagagtgcggcggagagttt
ttggttcgctgggacgactgcgccgcacgggatcactgggggatcatgccgggggagatc
gatgccgggacggtcacctgcaaggggaatatcatgtgcagggtcgacccccctgccgac
gcttcttccctggaagaggcgatcgtcaccgccgtccgtctccggagcgatgaaggagtg
acggccctctccggtggcgtcgactcgaccctggttgcggccatcgcagagcggccgtgc
gtcgcggttggggtcgaggattcgcatgaccttgtccgggccaggcatgcagccgaggct
ctgcacctctcctgtgattatgttacgatcaaaccggatgcggttgaagaagcgctggca
gcggtgatcccggtgatccctgcccgcgatccggtgaacatctcgatcgcggccacgatg
tactttgtcgcctcctatgcccgggagaacgggtatacccggatcctggccgggcagggg
gccgacgaactcttcggcgggtactcccggtacctggtgagcaccgaccttgcggccact
ttcgccgaggattttaagggacttgccctgcagggagcccgggaccaggccgttgcaggc
ctcttcggcgcctacctctcgatgccgtacctggatgtccgggttgtgcgcgctgccgag
gcgatcagtccctctgaccgggtctccggcgggatccggaaaaaaccgctcagagaggtt
gcagcacggtatattccggcagagatcgcagattacgataagaaggcgatgcagtatgga
accggggtctggaaggtgatccagcacctcgcccgtcacaatggttataacaagtcggta
caagggtacttaaatcacgtggggagactacacgatggtgcttga

DBGET integrated database retrieval system