KEGG   Candidatus Methanosphaerula palustris: Mpal_1453Help
Entry
Mpal_1453         CDS       T00823                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00010  Glycolysis / Gluconeogenesis
mpl00052  Galactose metabolism
mpl00500  Starch and sucrose metabolism
mpl00520  Amino sugar and nucleotide sugar metabolism
mpl00521  Streptomycin biosynthesis
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01120  Microbial metabolism in diverse environments
mpl01130  Biosynthesis of antibiotics
mpl01200  Carbon metabolism
Module
mpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1453
   00052 Galactose metabolism
    Mpal_1453
   00500 Starch and sucrose metabolism
    Mpal_1453
   00520 Amino sugar and nucleotide sugar metabolism
    Mpal_1453
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mpal_1453
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mpal_1453
Enzymes [BR:mpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mpal_1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hexokinase_1 FGGY_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACL16776
UniProt: B8GI36
Position
complement(1500161..1501138)
Genome map
AA seq 325 aa AA seqDB search
MTPDDRTGRTDTVIAVDLGATNLRVGLVNETGRIERLKVTTLPADLPDAETISDLIIRTI
HSLASDEEIGMSAGIGIGSAGPIDSTHTSIVHPPNIPLDIIPLSDPISAAFNLPVLLIND
CFAGLLGEACFGEGTGSKNFVYVTMSTGIGAGIIANGKILTGRSGNAGEIGHLFVDSDYN
LTCGCGRKGHWEGYASGRFLPRFYHEWLKKNGWDSGDQQIHSARDVFDAIREEQGSEKCG
FIHELGRLNGRGISDLIVAYEPDTIVFDGSVVLNNQDLIIPLIEQYADRYLPMPRLTVSS
LSGFAPLLGSSVIARGYETRFGSLE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagatgacagaaccggacgtactgataccgtcattgccgtcgaccttggagcg
accaaccttcgggtggggcttgtcaatgaaaccgggcgcattgaacggttgaaagtgacc
acacttcctgctgatctgcctgatgcggagaccatctccgatctcatcatccggacaatt
cattcgctggcatcagacgaggagatcgggatgtcggcaggcatcggtatcgggtcggca
ggaccgatagacagcacccacacctcgatcgtgcatcccccgaacatccccctcgatatc
attcccctgtcggacccgatcagtgcagcgttcaacctcccggtgctgctgatcaacgac
tgctttgcaggtctcctgggcgaggcgtgttttggcgagggtacgggatcgaagaatttc
gtctatgtaaccatgtcgaccggcatcggtgccgggatcattgcaaacggaaaaatactt
accggtcgatcaggaaacgccggggagatcggtcatctgttcgtcgacagcgattataac
ctgacctgcgggtgcggcagaaagggacactgggaaggatatgcatccggccggttcctg
ccccgcttctaccatgaatggctgaagaagaatggatgggattccggggatcagcagata
cactctgcccgggatgtctttgacgccattcgagaagaacagggttctgagaaatgcggt
tttattcatgaactcgggagactgaatggacgggggatttcagatctcattgttgcctat
gaaccggatacgatcgtctttgacggttctgttgttctgaacaaccaggacctgatcatt
cccctgatcgagcagtatgccgaccgttatctgccgatgccccggctgactgtgagcagt
ctttcgggttttgcaccgcttcttggttcttcggtcattgcccggggatacgagacacgg
tttggatcactggaatag

DBGET integrated database retrieval system