KEGG   Candidatus Methanosphaerula palustris: Mpal_1731Help
Entry
Mpal_1731         CDS       T00823                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00010  Glycolysis / Gluconeogenesis
mpl00051  Fructose and mannose metabolism
mpl00562  Inositol phosphate metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01120  Microbial metabolism in diverse environments
mpl01130  Biosynthesis of antibiotics
mpl01200  Carbon metabolism
mpl01230  Biosynthesis of amino acids
Module
mpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1731
   00051 Fructose and mannose metabolism
    Mpal_1731
   00562 Inositol phosphate metabolism
    Mpal_1731
Enzymes [BR:mpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpal_1731
Exosome [BR:mpl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpal_1731
  Exosomal proteins of bladder cancer cells
   Mpal_1731
  Exosomal proteins of melanoma cells
   Mpal_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG
Motif
Other DBs
NCBI-ProteinID: ACL17038
UniProt: B8GJJ7
Position
complement(1801099..1801767)
Genome map
AA seq 222 aa AA seqDB search
MSSQFILVNLKAYKEGMGPRAHMIARAAEEVSEESGIQIGVAPSFFDLHPLSKHFEIPVF
AQHLDGVVPGAFTGHVTAAAVRQTGAVGTLINHSERRLTLAEIEASVRAATEAGLVTVIC
SNNDMTSAAAAALSPTYVAIEPPELIGSGVSVAKADPGIIQRSVAAVHAVNPKVKVLTGA
GIQSGECVKIARDLGTDGVLLASSVVKVEDPAIVLRDLVSLL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacagttcattctggtaaacctcaaggcctacaaggaagggatgggcccccga
gcccatatgattgcgcgagctgcagaagaggtcagtgaggagagcggcattcagatcggg
gtcgcaccctcgttcttcgacctccatcctctgagcaaacactttgagatcccggtcttt
gcacagcatctggacggcgttgtccctggtgcgtttaccggtcatgtgaccgccgccgcg
gtcagacagaccggtgcggtggggactctgatcaaccactctgaacggaggctgactctt
gctgagatcgaagccagtgtgcgggctgcgacggaagcagggctggtcacggtgatctgt
tcaaacaacgatatgaccagtgcagcggcagcggccctttcaccgacctatgttgcgatt
gaaccgccagaactgatcggtagcggggtgtcggtggccaaggcggaccccgggatcata
caacgatcagtggcagccgtgcacgcggtgaatccaaaggtgaaggtgttgaccggtgcc
ggcatccagtcgggggaatgtgtgaagatcgcccgtgacctcggaacagatggtgtactg
ctcgcctcaagcgtggtcaaagttgaagaccctgccatcgtgctcagagatctggtctcc
cttctctag

DBGET integrated database retrieval system