KEGG   Candidatus Methanosphaerula palustris: Mpal_2749Help
Entry
Mpal_2749         CDS       T00823                                 

Definition
(GenBank) uroporphyrinogen-III synthase-like protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00860  Porphyrin and chlorophyll metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01120  Microbial metabolism in diverse environments
Module
mpl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpal_2749
Enzymes [BR:mpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mpal_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACL18011
UniProt: B8GFX8
Position
2876572..2877255
Genome map
AA seq 227 aa AA seqDB search
MKIAITRLAGKEENDAARCNAFGHTSEAVSPLRAEVYADQIEAFVQAVTEGQFDCLFFTS
ALPAQLIGPHLNTWPRVVAIGPTTAATLQQHGIPAETLSMFYSREFVPYLGSWISMKTIG
IPRADVPNQALLDSITGAGGIPREFRCYGLVKTGEPLQTADAGAILFTSAMSYREARWTP
RPDLLVGAIGEVTADAVRAGGTPVDVIGDGSLEGFLTALNRFIEERS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcaatcacccggcttgctggcaaggaagagaacgatgctgcccggtgcaat
gcattcggccacaccagtgaggccgtctccccccttcgggccgaggtgtacgccgaccag
atcgaagcgtttgtgcaggcggtcaccgagggacagttcgactgcctcttcttcaccagt
gccctgccagcccagttgatcgggcctcacctgaacacctggccgcgggtggtggcgatc
gggccgaccaccgcagcgacactccagcagcacgggatcccggcagagaccctctcgatg
ttctactcgcgagagttcgttccctacctgggctcctggatcagtatgaagacaatcggg
atcccgcgtgccgacgtcccaaaccaggctctcctcgattcgatcaccggagccggcggg
atcccgcgggagttccgatgctacgggctcgtgaagaccggagaacccctccagaccgct
gacgccggggcgatcctcttcaccagtgcgatgtcgtacagagaggcacgctggacaccc
cgcccggatctgctggtcggcgccatcggcgaggtgacggcggatgcggtcagggccggc
ggaacaccggtggatgtgatcggtgacggttccctagaggggttccttacggcactgaac
cgattcatagaggagcgatcatga

DBGET integrated database retrieval system