KEGG   Methanosphaerula palustris: Mpal_2757Help
Entry
Mpal_2757         CDS       T00823                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
mpl  Methanosphaerula palustris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 MFS_4 MFS_2 PUCC TRI12 Folate_carrier BT1
Motif
Other DBs
NCBI-ProteinID: ACL18016
UniProt: B8GFY3
Position
2885671..2886900
Genome map
AA seq 409 aa AA seqDB search
MNQHRQIPPAEKRQFLLFLILCSIGGLAIFSSTISKNPVLPILAQTLGANLQTIGLIAAA
STVTGIVTSLWAGSLSDRYGRRPMLILSGIVFFTAPVLYLLVHTPLDLALVRVYHGLATA
IFGPVAMAYVTDLTPVRRGERLGYFSSFQLAGRSVAPLAGGAILAIGVWQLVYLVCAVAG
ALTLAGMVLLPEPDRIGSEERDEEPAPESDTTSMGSAFRAVISDRTILITSLAEASGFFA
FGAIEAFLPLYALNAGIDTLMIGLLFLVQVGVRTLTRPLFGKVSDQRGRKAQITAGLLLT
AATAALFPYTTAWPVLLCLSALFGMGFSVASAATSAFVADLAPSRGRGTALGLMSTIMDI
GQAAGPILMGGLLALFSYHTGFGVTGAVVLVCAILFQWLAVEERQKLKK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcaccggcagattcccccggcagagaagcggcagttcctcctctttctaatc
ctctgctcgatcggagggctggccatcttcagctcgacgatcagcaagaatccggtcctc
ccgatcctcgcccagaccctcggagcaaacctccagacgatcgggctgatcgctgccgct
tcgaccgtgaccgggatagtaaccagcctctgggcaggctctctctctgaccgctacggc
cggcggccaatgctgatcctctctggcatcgtcttcttcactgccccggtcctgtacctg
ttggttcatacgccgctcgacctcgcgctggtcagggtctaccatggtctcgccaccgcc
atcttcggccctgtcgcgatggcctacgtcaccgacctgaccccggtgagacgtggagaa
cggctcggctacttctcctcattccagctcgccggcagatcggtcgccccgcttgccggc
ggtgcaattctggccatcggggtctggcagctggtgtacctggtctgtgccgtcgccggt
gccctgaccctcgccggaatggtgctactgccggaaccggatcggataggcagcgaggag
agggatgaagagcctgcacccgaatctgacaccacgagcatggggtccgccttcagggct
gtgatcagcgaccggacgatcctgatcacctccctggccgaggcctcaggtttcttcgca
ttcggcgccatcgaggcgtttctcccactatacgccctgaacgcagggatcgatactttg
atgattggcctcctcttcctggtgcaggttggggtcagaaccctgaccaggcccctcttc
ggcaaggtcagcgaccagcgggggcgcaaggcacagatcaccgccggtctgctactgacg
gccgctaccgccgccctcttcccgtacaccaccgcctggccggtgctcctctgcctctcc
gccctctttggaatgggcttctcggtcgcttcggctgctacctcagccttcgtcgcggac
ctggcacccagccgtggccggggtaccgccctcgggctgatgtcgacgatcatggacatc
ggccaggctgcaggaccgatcctgatgggcgggctgctggcgctcttctcctaccacacg
gggttcggagtgaccggggcagtcgtactcgtctgtgctatcctcttccagtggttggcc
gttgaagaacggcaaaaattaaaaaaatga

DBGET integrated database retrieval system