KEGG   Mycoplasma pneumoniae M129: MPN240
Entry
MPN240            CDS       T00006                                 

Gene name
trxB
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
mpn00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:mpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MPN240 (trxB)
Enzymes [BR:mpn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     MPN240 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Lycopene_cycl Thi4 GIDA FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 K_oxygenase
Other DBs
NCBI-GeneID: 877259
NCBI-ProteinID: NP_109928
UniProt: P75531
Position
292328..293275
AA seq 315 aa
MLKVKSDFLTKDQVIYDVAIVGAGPAGIAAGIYGKRANLNLAIIEGSTPGGKVVKTNIVE
NYPGYKSITGPDLGLEMYNHLIDLEPTFFYANLIKLDKAADTFILYLDDKTVVFAKTVIY
ATGMLERKLGVAKEDHFYGKGISYCAICDGSLYKDQVVGVVGGGNSAIQEALYLASMAKT
VHLIHRREGFRADETALNKLRNLPNVVFHLNYTVKELLGNNTLNGIVLQNTLDHSTKQID
LNCVFPYIGFESITKPVEHLNLKLDPQGFLITNEQMETSLKGLFAAGDCRSKHFRQIGTA
INDGIIAVLTIRDVL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcttaaagtaaagtcagattttttaactaaagatcaggttatttacgatgtagcgata
gtgggtgctgggccagctggcatagcagcgggtatttatggcaaacgcgctaacctcaat
ctagccattattgaaggtagtactcccggcggtaaggttgtcaaaaccaacattgtcgag
aactatccgggttacaagtcaattaccggacctgacttggggttggaaatgtacaaccac
ctaattgatttagagcccacctttttctatgctaacctaattaagttagataaggcagca
gatacctttatcttgtacctcgatgacaaaactgtggtgtttgccaaaaccgttatttac
gctacgggaatgttggagcgtaaactgggcgtagccaaagaagaccacttttacggtaag
ggaattagttactgtgccatttgtgatgggtccttgtacaaagaccaggtggtgggtgtt
gttggtggggggaactctgccattcaggaagcgttgtatttagctagcatggctaaaacg
gtgcacttaatccaccgccgtgagggctttcgtgctgatgaaacggcgttaaataaactg
agaaacttaccgaatgttgtttttcacttgaactataccgtaaaagaattgttgggtaac
aataccctaaacggcatagtgcttcaaaacacgctcgatcattcaacaaaacagatagat
ctcaattgtgtctttccctatattggttttgaaagtattaccaaaccggtggaacacctc
aacttaaagttagatccccagggttttttaattaccaatgaacagatggaaacaagttta
aagggtctgtttgcagcaggtgattgtcgttctaagcacttccgtcaaattggtactgcc
attaatgacggcattatcgcggtgttaacgatccgtgatgtcctttag

DBGET integrated database retrieval system