KEGG   Mycoplasma pneumoniae M129: MPN355
Entry
MPN355            CDS       T00006                                 

Gene name
yacO
Definition
(RefSeq) 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB
  KO
K03218  23S rRNA (guanosine2251-2'-O)-methyltransferase [EC:2.1.1.185]
Organism
mpn  Mycoplasma pneumoniae M129
Brite
KEGG Orthology (KO) [BR:mpn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mpn03009]
    MPN355 (yacO)
Enzymes [BR:mpn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.185  23S rRNA (guanosine2251-2'-O)-methyltransferase
     MPN355 (yacO)
Ribosome biogenesis [BR:mpn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MPN355 (yacO)
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Other DBs
NCBI-GeneID: 876924
NCBI-ProteinID: NP_110043
UniProt: P75424
Position
complement(423510..424238)
AA seq 242 aa
MKRMQETSFLFGSKAFLEALDNQLQIKKVNLSDKHQKLLGLIKKRGLRYEMHSSQWFHQQ
FRHINHQEFVCVINPNQMLKTIEQLIQITDSKSTSTLVMLHEIQDPHNFGAILRTCMAAE
VDGIIFKKHNQAPINSTVIRTSMGTVFYQNLVQVTNLSYAITTLQKHGFWTVATTLDERL
KPKDYRQVDFDKRILLVGNEDKGLNALLLKNADLKVKIPMNPKLNSLNVSVAVGIILFGW
KS
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaagcggatgcaagaaaccagttttttatttggtagtaaggcctttttggaagcgtta
gataaccaactgcaaattaaaaaggtcaatttatctgataagcaccaaaagctgttgggc
ttaattaagaaacggggattgcggtatgaaatgcactccagccagtggtttcaccagcag
tttcgccacattaaccaccaggaatttgtttgtgtaatcaaccctaaccaaatgctcaaa
acaattgagcagttaatccaaattacagacagcaagtccaccagtaccctggtaatgctc
catgagatccaagatccgcataactttggcgccatcttgcgcacctgtatggcagctgaa
gtggatgggattatctttaaaaagcataaccaggcgcccattaacagtaccgttattaga
accagtatgggaactgtcttttaccagaacttagtgcaggttactaacctcagttatgcc
attactaccctgcaaaaacacggcttttgaacggtcgctacaacattagatgagcgctta
aagccaaaagattaccgccaagtagactttgacaagcgcattttactggtaggtaatgaa
gataagggcttaaatgcactactgttaaaaaacgctgatttaaaggtcaaaattccgatg
aatcccaagctcaactcactcaatgttagtgttgccgtggggattatcttgtttggatga
aaaagctaa

DBGET integrated database retrieval system