KEGG   Mycoplasma pneumoniae M129: MPN564Help
Entry
MPN564            CDS       T00006                                 

Gene name
adh
Definition
(RefSeq) NADP-dependent isopropanol dehydrogenase
Organism
mpn  Mycoplasma pneumoniae M129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 876853
NCBI-ProteinID: NP_110253
UniProt: P75214
Position
complement(684729..685784)
Genome map
AA seq 351 aa AA seqDB search
MKAYAMLKIGATGWIEKPRPVCGPNDAIIRPLAVAPCTSDVHTVWEGGIGERHNMVLGHE
GCGVVDEVGSEVKSFKVGDRVLVAAITPEWNSVNAQAGYPMHSGGMLGGWKFSNVKDGMF
AEYFHVNDAEGNLALMPEGMDLADACMLSDMIPTGFHANELADIQYGVALSFFCAGPVGL
MAIAGAALKGAGRIIVVDSRPDIVEIAKAYGATDYIDFKKVSVVDEILKWTNNEGVEKVL
ISGGGSTILETAIKVLRPGGKIGNVNYFGAGEFLTIPRVEWGVGMAHKAIHGGLMLGGRL
RLEKLARLIMTKKLDPSKMITHRFKGFEHIEEALFLMKDKPKDLIKSVVIF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatatgcaatgttaaaaattggcgctactggttgaatcgaaaaaccaagacca
gtttgtgggcccaatgatgcgataattcgaccactggccgtagcaccatgtacttcagac
gtccacaccgtttgggaaggtggcattggtgaacgtcacaacatggttttaggccatgag
ggctgtggtgttgtggatgaagtggggtctgaggtcaaaagctttaaggttggtgatcgc
gttttagtggcagccattacaccagaatgaaattcggttaatgctcaagctggataccct
atgcactccggtggcatgctgggtggttggaagttttccaacgttaaagatggcatgttt
gctgaatactttcacgtcaatgatgctgagggtaacttagcattgatgccagaagggatg
gatttagctgatgcatgtatgttgtcagacatgattcccacaggctttcacgccaatgaa
ctagctgacatccaatacggtgtcgcgttgtcgtttttttgtgctggtccagttggttta
atggcgatcgctggtgcagccttaaagggtgctggacgcattattgtggtggattctaga
ccagatattgtggaaattgccaaagcatacggtgcgactgattacattgatttcaaaaag
gtttcagttgtggatgaaatcttgaagtgaaccaacaatgaaggagtggaaaaggtgtta
atttctggtggtggttcgactatcttagaaacagcgattaaggttttaagaccaggaggc
aaaattggtaacgttaattactttggcgctggtgagtttttaactattcctagagttgaa
tggggcgttggtatggctcacaaggccattcatggtggtcttatgcttggtggtcggtta
aggttagaaaaattagcacgtttaattatgaccaaaaaactcgatccttccaaaatgatt
acccatcgctttaagggttttgaacacattgaagaagccctgtttttaatgaaagataaa
ccgaaggacttaattaaatccgtggttattttttaa

DBGET integrated database retrieval system