KEGG   Mycoplasma pneumoniae M129: MPN667Help
Entry
MPN667            CDS       T00006                                 

Gene name
gtaB
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
mpn00040  Pentose and glucuronate interconversions
mpn00052  Galactose metabolism
mpn00500  Starch and sucrose metabolism
mpn00520  Amino sugar and nucleotide sugar metabolism
mpn01100  Metabolic pathways
mpn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPN667 (gtaB)
   00052 Galactose metabolism
    MPN667 (gtaB)
   00500 Starch and sucrose metabolism
    MPN667 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MPN667 (gtaB)
Enzymes [BR:mpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPN667 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 877017
NCBI-ProteinID: NP_110356
UniProt: P75124
Position
790153..791028
Genome map
AA seq 291 aa AA seqDB search
MPKIRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSK
KEAIIDHFDYDFILENALLQKHKDQEHQEIKDIANLAHIYFVRQKHQHGLGDAILHAKSF
VGNEDFAVLLGDDVVFGEQPALAQCIQAYEQTDCQVIGVQEVPHDQVNKYGIVTPEANWQ
KQALVKILGMVEKPAVNEAKSNLAILSRYILKPSIFTALKQVPFGVGGELQLTDGLNYCL
QQGEPFFAKHFGGTRFDVGTKNGFIKANLYTALKTDAITKDEVLAILKEFA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaataagaaaagccgttattcccgcagccggactgggtaccagattactccca
gccactaaggccattcccaaagagatgttgcccttagtcaataaacccacaattcagtac
attgtggaagaagcagtagcgagtggcattaaggaaatcctagtaattgtgtcttctaaa
aaggaagcgattattgaccactttgactatgactttatcttggaaaatgctttactccaa
aagcacaaagatcaagaacaccaagaaattaaggatattgccaacttagcgcacatttac
tttgtccgccaaaaacaccaacacggtttaggagatgccattttgcacgccaagtcgttt
gttggtaacgaagactttgccgtccttttaggtgatgatgtcgtgtttggtgaacaaccg
gcattagcacaatgtattcaagcttatgaacaaacagattgtcaggtaataggcgtgcaa
gaagtgccccatgaccaggtcaacaagtatggcatagtaacccctgaagctaattgacaa
aaacaagcgttagtcaaaattttgggcatggtggaaaaaccagctgtcaacgaagccaag
agcaacctagccattttgagccgttacatccttaaacccagtatttttacagctcttaaa
caagtaccgtttggtgttgggggtgagttacagttgactgatgggttgaactattgttta
cagcaaggggaacccttctttgccaagcactttggtggtacccggtttgatgtcggtact
aaaaatggttttattaaagcgaacctgtacacggctttaaaaaccgatgccattactaag
gatgaagtcttggccatcctcaaggaatttgcttaa

DBGET integrated database retrieval system