KEGG   Methylobacterium populi: Mpop_0420Help
Entry
Mpop_0420         CDS       T00760                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mpo  Methylobacterium populi
Pathway
mpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mpop_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACB78598
UniProt: B1ZJ24
Position
449570..450493
Genome map
AA seq 307 aa AA seqDB search
MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPAGNAGYPLPEPEPKSGGAAAEAPKA
EPIAVRLASADADKGKGGTKACQACHSFEKGGPNKVGPDLWDIVERQKAHHEGFDYSAGL
KEKGGSWTYEDLDHFLENPKGYVKGTKMAFAGISSPTERANVIAYLRTLSDSPKPLPAAE
KKAEAAPEGEKKGEAAKPAENKPAEEKKAEDKAPAKAEPRPVESATGDKDKAPETNAPKG
DTRSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTKAEPGSEITPATEPPAKA
DPEAPKP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagctgaacaaggttgcgggcgctgtcctgggtgccctcctgttcgcg
gtcgggtcgggcttcgtggcggagctgatctatcatcccaagcccgccgggaatgccggc
tatccgctgcccgagccggagccgaagagcggcggcgccgcggccgaggcaccgaaggcc
gagcccatcgccgtgcggctcgccagcgccgacgccgacaagggcaagggcggcaccaag
gcctgccaggcctgccacagcttcgagaagggcggcccgaacaaggtcggtcccgacctc
tgggacatcgtcgagcgtcagaaggcccatcacgagggcttcgactactccgccggcctg
aaggagaagggcggttcctggacctacgaggatctcgaccacttcctcgagaacccgaag
ggttacgtgaagggcaccaagatggcgttcgccggcatcagctcgccgacggagcgcgcc
aacgtcatcgcctatctgcgcacgctctcagacagccccaagcccctgccggccgccgag
aagaaggccgaggcggcgcccgagggggagaagaagggcgaggccgcgaagccggcggag
aacaagcccgccgaggagaagaaggccgaggacaaggcgcccgcgaaggcggagccgagg
ccggtcgagagcgccaccggcgacaaggacaaggcgcccgagaccaacgcgccgaagggc
gacacccgctccggcgacggcaaggacaccgcccgcccggtcccggcgccccaggtccag
ccccagcgcaacgaggtcgccccgacccaggcccccgaggccaagccctcgggcgacatc
ccgaccaaggccgagcccggctccgagattacgccggccaccgaaccgccggccaaggcc
gatccagaggcgcccaagccgtaa

DBGET integrated database retrieval system