KEGG   Methylorubrum populi: Mpop_0435Help
Entry
Mpop_0435         CDS       T00760                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mpo  Methylorubrum populi
Pathway
mpo00860  Porphyrin and chlorophyll metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpop_0435
Enzymes [BR:mpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Mpop_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ACB78613
UniProt: B1ZJ39
Position
complement(468329..469681)
Genome map
AA seq 450 aa AA seqDB search
MRQDLKAHYADERLPRYTSYPASPHFTGAVGPAAYAEWLRALPAETTASLYLHVPFCRSL
CWYCGCHTHITRHDAPIDDYLASLRKEIGLVAGHLERRPAVRHVHFGGGTPTIMAPAAFR
ELMALLRAHFPFAPEAEIAVEIDPRTLAPAMIRALGEAGVTRASLGVQSFDPAVQAAIRR
RQDYAVTEAAVAGLRAAGIRRINLDLIYGLPHQSVESCVETVRQCLALRPDRLAVFGYAH
VPSFKKHQRLIDAATLPDAAARRAQAQAVADALAGAGYRRIGLDHYALPDDPMAVARAEG
QLHRNFQGYTTDSSDALIGFGASAIGRLPQGYVQNEPALRAYAARVAANDVATVRGYALT
PEDRLRAALIERIMCDGAVEVGAVCRSHGRDPEALLASLPRLRALTDHGLVKREGMRLTI
PDDARAFVRNVAALFDAHLGTSAAMHSCAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcaggacctgaaggcacattacgcggacgagcgactgccgcgttacacgagctat
ccggcgagcccgcatttcaccggcgcggtcggtccagctgcctatgccgagtggctgcgt
gcgcttccggccgagacgacggcctcgctctacctccatgtgccgttctgccgttccctc
tgctggtactgcggctgccacacccacatcacccggcacgacgcgcccatcgacgattac
ctcgcgagcctgcgcaaggagatcggcttggtcgccgggcatctggagcgccggcccgcc
gtacgtcacgtccatttcgggggcggcacccccaccatcatggcgcccgccgcattccgt
gaactgatggcgctgctgcgggcgcacttcccgttcgcccccgaggccgagatcgccgtc
gagattgatccgcggacgctcgcgcccgcgatgatccgggccctcggcgaagccggggtc
acgcgggcgagcctcggcgtccagagcttcgatccggcggtgcaggcggcaatccggcgc
cggcaggactacgccgtcaccgaagcggccgtcgccggcctgcgggcggccgggatccgc
aggatcaacctcgacctgatctacggcctgccgcaccagagcgtggaatcctgcgtcgag
acggtgcggcaatgcctggcgctccggcccgaccgtctcgcggtgttcggctacgcccat
gtccccagcttcaagaagcaccagaggctcatcgatgcggcgacattgccggacgccgcc
gcccgccgggcgcaggcgcaggccgtcgccgatgcgctcgccggggccggctatcgtcgg
atcggcctcgaccattacgccctgccggatgacccgatggcggtcgcgcgggcggaaggc
caactccaccgcaacttccagggctacaccaccgattccagcgacgcgctgatcggcttc
ggcgcctccgccatcgggcggctgccgcagggctacgtccagaacgagccggcactgcgt
gcctacgccgctcgtgtcgccgccaacgacgtggcgacggtgcggggctatgccctgacg
ccggaggatcggctgcgggccgccttgatcgagcggatcatgtgcgatggcgccgtcgag
gtcggggcggtctgccggtcgcacggccgggatccggaggcgctgctcgcctccctgccg
cggttacgcgccctcaccgatcacggcctggtcaaacgtgaagggatgcgcctgacgatc
cccgacgatgcgagggctttcgtccggaacgtcgcggcgctgttcgatgcgcatctgggg
acatccgccgccatgcatagctgcgcggcgtaa

DBGET integrated database retrieval system