KEGG   Methylobacterium populi: Mpop_1586Help
Entry
Mpop_1586         CDS       T00760                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpo  Methylobacterium populi
Pathway
mpo00020  Citrate cycle (TCA cycle)
mpo00640  Propanoate metabolism
mpo00660  C5-Branched dibasic acid metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
Module
mpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpop_1586
   00640 Propanoate metabolism
    Mpop_1586
   00660 C5-Branched dibasic acid metabolism
    Mpop_1586
Enzymes [BR:mpo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mpop_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACB79750
UniProt: B1ZG92
Position
complement(1713122..1714318)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSRGVAIFKPEEAAAAADELGGPVWVVKSQIHAGGRGKGTFK
GAPAGAKGGVRVTKSKDEVVQFAREMLGQTLVTVQTGEAGKQVNRLYIEEGASIASEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALGLS
GPQAKEAGALTEKLYAAFTAKDMSMLEINPLVLTGDGHLKCLDAKISFDSNALYRHPEIV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPQVKGILVNIFGGIMKCDVIARGVIAAVKAVGLEVPLVVRLE
GTNVEEGKEIIRTSGLNVIPADDLDDAAQKIVAAVKKG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggcgaaggctgtcctcaaggaattcggtctgccggtttcc
cgcggcgtggcgatcttcaagccggaggaagccgccgcggcggccgacgagctcggcggc
ccggtctgggtggtgaagtcgcagatccatgccggcgggcgtggcaagggcaccttcaag
ggtgcgcccgcgggcgccaagggcggcgtgcgcgtcaccaagtcgaaggacgaggtggtg
cagttcgcccgcgagatgctcgggcagaccctggtgacggtgcagaccggcgaggccggc
aagcaggtcaaccgtctctatatcgaggaaggcgcctcgatcgcctccgagttctacctg
tcgatgctggtcgatcgcgagaccggccgcgtcgccttcgtcgtctcgacggaaggcggc
atggacatcgagcaggtcgcccacgacacgcctgagaagatcgtcactttctcggtcgat
ccggccaccggcatcatgccccatcacggccgtgcggtcgccaaggcgctgggcctgtcc
ggcccgcaggccaaggaagccggcgcgctgacggaaaagctctacgcggcctttacggcc
aaggacatgagcatgctggagatcaacccgctggtgctcaccggcgacggtcatctcaag
tgcctcgatgccaagatctccttcgattcgaacgccctctaccggcatcccgagatcgtg
gcgctccgcgacgagaccgaggaggacgccaaggagatcgaggcgtcgaaatacgacctc
gcctacatcgcgctggacggcaccatcggctgcatggtgaacggcgcggggctcgccatg
gccaccctcgacatcatcaagctctacggcgaggagccggcgaactttttggacgtcggc
ggcggcgcctcggaagaaaaggtgacggcggcgttcaagatcatcaccgccgatccgcag
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtcatcgcccgc
ggcgtgatcgcggcggtgaaggcggtcggtctcgaagtgccactcgtcgttcggctcgag
ggcaccaacgtcgaggagggcaaggagatcatccgcacctccggtctcaacgtgatcccc
gcggacgatctggatgatgccgcgcagaagatcgtcgccgcggtgaagaagggctga

DBGET integrated database retrieval system