KEGG   Methylobacterium populi: Mpop_2494Help
Entry
Mpop_2494         CDS       T00760                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpo  Methylobacterium populi
Pathway
mpo00010  Glycolysis / Gluconeogenesis
mpo00620  Pyruvate metabolism
mpo00640  Propanoate metabolism
mpo00680  Methane metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_2494
   00620 Pyruvate metabolism
    Mpop_2494
   00640 Propanoate metabolism
    Mpop_2494
  Energy metabolism
   00680 Methane metabolism
    Mpop_2494
Enzymes [BR:mpo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpop_2494
Lipid biosynthesis proteins [BR:mpo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpop_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACB80655
UniProt: B1ZB59
Position
2711266..2713215
Genome map
AA seq 649 aa AA seqDB search
MSEKVIDVQDAWRERALIDDAKYKEMYAASVSDPETFWAEHGRRIDWSTPFSKVKNTSFA
PGNVSIKWFEDGKTNVALNCIDRHLETRGDQTAIIWEGDDPNESQHITYKQLHAEVCRMA
NVLRNRGVGKGDRVTLYLPMIPEAAYAMLACARLGAIHAIVFGGFSPDSLASRIKGCGSK
LVITADEGLRGGRKVPLKANVDEAIKRLDADLVDHVIVVKRTGGNVAMEPGRDVYYHEAA
EQVTDECPAEAVEAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHQYVFDYHDGDVY
WCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSRFWEVIDKHKVNIFYTAPTAI
RSLMGGGEGPVKKTSRASLRVLGSVGEPINPEAWDWYYRVVGDSRCSIVDTWWQTETGGI
LITPLPGATKLKPGSATRPFFGVQPVMVDAEGKELDGACEGNLCIKDSWPGQMRTVYGDH
ERFEQTYFSTYKNLYFTGDGARRDADGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPK
VSEAAVVGYPHNVKGQGIYAYVTLNEGEDGSDELRKELVTWVRKDIGPIASPDLIQFAPG
LPKTRSGKIMRRILRKIAEDDFGSLGDTSTLAEPAVVDDLIENRQNRSA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaggtcatcgacgttcaggatgcctggcgggaacgggctttgatcgacgac
gccaagtacaaggagatgtacgccgcgtccgtttccgatcctgagacgttctgggccgag
cacggtcggcggatcgactggtccacgcccttcagcaaggtcaagaatacgagcttcgcg
cccggcaacgtctcgatcaaatggttcgaggacggcaagaccaacgtcgcgctcaactgc
atcgaccggcacctcgagacccgcggcgaccagaccgcgatcatctgggaaggcgacgat
cccaacgagtcgcagcacatcacctacaagcagttgcacgcggaagtgtgccggatggcc
aacgtcctgcgcaaccgcggcgtcggcaagggggaccgcgtcacgctctacctgccgatg
atccccgaggccgcctacgcgatgctggcctgcgcccggctcggggccatccacgccatc
gtcttcggcggcttctcgcccgattccctcgcgagccggatcaaaggctgcggctccaag
ctcgtcatcaccgccgacgagggcctgcgcggcgggcgcaaggtgcctctcaaggccaat
gtcgacgaggcgatcaagcgcctcgatgcggacctcgtggatcacgtcatcgtggtgaag
cgcaccggcggcaacgtggcgatggagccgggccgcgacgtctattaccatgaggccgcc
gagcaggtgaccgacgagtgcccggccgaggcggtcgaggccgagcatccgctcttcatt
ctctacacctcgggctcgaccggccagccgaagggcgtggtgcacaccaccggcggctat
ctcgtctatgcctcgatgacccaccaatacgtgttcgactaccacgacggcgacgtctac
tggtgcacggcggatgtgggctgggtcaccggccacagctacatcgtctacggcccgctc
gcgaacggcgcgaccacgctgatgttcgaggggatcccgacctacccgtcgaactcccgc
ttctgggaagtcatcgacaagcacaaggtcaacatcttctacaccgcgccgaccgcgatc
cgctcgctcatgggcggcggcgagggcccggtgaagaagacctcgcgcgcctcgctgcgg
gtgctgggctcggtcggcgagccgatcaacccggaagcctgggactggtactaccgcgtg
gtcggcgattcccgctgctccatcgtcgatacgtggtggcagaccgagaccggcggcatc
ctcatcaccccgctgcccggcgcgaccaagctcaagcccggctctgcgacccggcccttc
ttcggcgtgcagccggtgatggtcgatgccgagggcaaggaactcgacggcgcctgcgag
ggcaacctctgcatcaaggacagctggccgggccagatgcgcaccgtctacggcgaccac
gagcgcttcgagcagacctacttctcgacctataagaacctctacttcaccggcgacggg
gcgcggcgcgacgccgacggctactactggatcacgggtcgcgtggacgacgtcatcaac
gtctccggccaccgcatgggcacggcggaagtcgaatcctcgctcgtcgcccatccgaag
gtctccgaggccgcggtggtgggctatccccacaacgtgaagggccagggcatctacgcc
tacgtcaccctcaacgagggcgaggacggctccgacgagctgcgcaaggaactcgtcacc
tgggtgcgcaaggatatcggcccgatcgcctcgccggatctgatccagttcgcgccgggc
ctgcccaagacccgctcgggcaagatcatgcgccgaatcctgcgcaagatcgccgaggac
gatttcggttcgctcggcgacacctcgaccctggccgagccggcggtggtcgacgacctg
atcgagaaccgccagaaccgctcggcctga

DBGET integrated database retrieval system